Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02857
Gene name
Locationscaffold_02:4951639..4953742
Strand+
Gene length (bp)2103
Transcript length (bp)2103
Coding sequence length (bp)2103
Protein length (aa) 701

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11374 DUF3176 Protein of unknown function (DUF3176) 9.2E-30 75 188

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane|Lysosome/Vacuole Signal peptide|Transmembrane domain 0.0949 0.0651 0.112 0.7603 0.0318 0.0091 0.1488 0.6051 0.4176 0.0066

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 55 77 22
2 97 119 22
3 165 187 22
4 593 615 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup395
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4550
Ophiocordyceps australis map64 (Brazil) OphauB2|5423
Ophiocordyceps australis map64 (Brazil) OphauB2|691
Ophiocordyceps camponoti-floridani Ophcf2|02857 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5234
Ophiocordyceps subramaniannii Hirsu2|1908
Ophiocordyceps subramaniannii Hirsu2|2155
Ophiocordyceps subramaniannii Hirsu2|2963
Ophiocordyceps subramaniannii Hirsu2|4498
Ophiocordyceps subramaniannii Hirsu2|7227

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02857
MDNQQTASSSDIELRLVEVDNQQTASSSDTELRPAGTGSTAKTQRRPWQKVRNIYPWFFEMASLVAAAALVAAIV
IILVGFDGEKLPQLPYSINLNTIIALLTLCLRASIALIAAGIISQSKWIWFSDKPRSLANFQTFDEASRGLLGSL
KLISLLRLSWRGSPLAVMAAITSILSLAISPFAQQAIKTLPCLRVSSSDGARIPVAMHLPGPDASSTEYTILDNR
AQGAIFSGITNPSGNESNIQSWCPTGNCTFPETLGVPHSTIGLCAQCLDTTSLVRISRRRDPEDGEETTVALLND
MVLSVKRFSPMLMAKSHVYPDSLSFASSLMTPGFESAAESSVANVSVMTYTRLKGEQCADGTFNASCVVAATCSL
YLCMKKFRASVVNGRLQESILDVVPSQVNRTADFGDHNEDRAMIKSPCLVNGQLYDETNFSSIRAEDVTGGARTI
PVFVKRRDSSRRTRTIKIDVPYDCLYTVDGDYVFMLGQFMQERLFSGFCNAGRGYKDNGNLDCNRTWWLHQFYNR
GSSSYDFINRAVQEMATATTNYFRTEAWTPDYDSAYSHVTPNVTGYSKAFIRGEIHQSSVCMRLDWPWLLLPVIL
CVATIVLLAAMLFVNAKHNHPPVWKSSTLPLLFFGLDGRGLQREESSDGACADDLASMGRQAKRTTACLDADGGL
SRTVLVALDGTDYGDGNETLSEDMS*
Coding >Ophcf2|02857
ATGGATAATCAGCAGACGGCGTCCTCCTCAGACATAGAGCTACGGCTTGTAGAGGTCGACAATCAGCAGACGGCA
TCCTCCTCAGACACAGAGCTACGGCCTGCAGGGACCGGCAGCACGGCCAAGACTCAAAGACGACCATGGCAAAAA
GTGAGGAACATTTACCCCTGGTTCTTTGAGATGGCCTCCCTCGTCGCCGCAGCAGCCCTCGTGGCCGCCATCGTC
ATCATCCTAGTCGGGTTCGACGGAGAGAAACTCCCGCAATTGCCGTACAGCATCAATCTCAACACCATCATCGCT
CTGCTCACTCTCTGTCTTCGCGCTTCCATCGCGCTTATCGCGGCCGGAATAATCAGCCAATCGAAATGGATCTGG
TTCTCCGACAAGCCGCGCTCGCTGGCCAACTTCCAGACGTTCGACGAGGCTAGTCGTGGCTTGCTCGGCTCCCTC
AAGCTGATATCCCTCTTGCGTCTCAGCTGGCGCGGCAGTCCCTTGGCAGTCATGGCCGCCATCACATCCATCCTC
AGTCTAGCCATCAGTCCCTTCGCTCAGCAAGCCATCAAGACTTTACCTTGCCTCCGTGTTTCCTCATCTGACGGC
GCCAGGATCCCGGTGGCCATGCACCTCCCCGGCCCGGACGCATCGTCTACGGAATACACAATCCTGGATAACAGG
GCCCAAGGCGCCATCTTCTCAGGTATCACGAATCCGAGTGGCAACGAGAGCAATATACAGTCCTGGTGCCCAACC
GGTAACTGCACCTTTCCCGAGACGCTCGGTGTGCCGCACTCGACGATAGGGCTCTGTGCTCAGTGTTTGGACACA
ACTTCGCTTGTGAGAATCTCTCGACGACGCGACCCCGAAGACGGTGAGGAAACGACGGTGGCTTTGCTTAACGAC
ATGGTGCTTAGCGTCAAGCGTTTCTCACCCATGCTCATGGCGAAATCGCATGTTTATCCTGACAGCCTATCCTTC
GCAAGTTCTCTCATGACTCCCGGGTTCGAAAGTGCCGCTGAGAGTTCCGTTGCCAACGTCTCCGTCATGACATAC
ACCAGACTCAAAGGCGAACAATGTGCCGACGGCACCTTCAATGCGTCTTGTGTTGTGGCCGCTACCTGCTCGCTC
TATCTCTGCATGAAGAAGTTCAGAGCCAGCGTCGTCAACGGCCGGCTACAAGAATCCATCCTGGATGTAGTGCCG
TCTCAAGTCAACAGAACGGCCGACTTTGGGGATCACAATGAAGATCGTGCCATGATCAAGAGCCCTTGCCTAGTC
AATGGCCAACTGTATGACGAGACTAACTTCTCCTCCATACGAGCCGAGGACGTGACGGGAGGAGCCAGAACGATA
CCCGTCTTTGTCAAAAGAAGAGACTCTTCCCGCCGGACCAGAACGATAAAAATAGATGTGCCTTACGACTGCTTG
TATACCGTTGACGGCGACTACGTCTTCATGCTCGGACAATTCATGCAAGAAAGACTATTTTCCGGCTTCTGCAAC
GCTGGTAGGGGATATAAGGACAACGGAAACTTGGACTGCAACCGAACCTGGTGGCTTCACCAGTTCTACAATCGC
GGCAGCTCGTCCTACGACTTCATAAACAGGGCTGTCCAAGAGATGGCAACGGCTACGACCAATTACTTCCGGACA
GAGGCATGGACTCCCGATTATGACAGCGCATACAGCCATGTCACCCCCAACGTCACCGGCTACTCCAAAGCCTTC
ATCAGGGGCGAGATCCACCAAAGCAGCGTCTGCATGCGCCTCGACTGGCCCTGGCTTCTGCTCCCCGTGATACTC
TGCGTCGCGACGATAGTCCTCCTAGCCGCCATGCTGTTCGTCAACGCGAAACACAACCACCCACCCGTCTGGAAG
TCGAGCACGCTTCCGCTCTTGTTCTTTGGCCTCGACGGCCGGGGTTTGCAGAGAGAGGAGTCGTCGGATGGAGCG
TGTGCCGATGATCTAGCCAGTATGGGGCGTCAGGCGAAGCGGACGACGGCTTGTTTGGATGCAGATGGTGGATTG
TCCCGGACCGTCTTGGTGGCCTTGGATGGAACCGACTACGGAGACGGCAATGAGACGTTGAGTGAAGACATGTCG
TGA
Transcript >Ophcf2|02857
ATGGATAATCAGCAGACGGCGTCCTCCTCAGACATAGAGCTACGGCTTGTAGAGGTCGACAATCAGCAGACGGCA
TCCTCCTCAGACACAGAGCTACGGCCTGCAGGGACCGGCAGCACGGCCAAGACTCAAAGACGACCATGGCAAAAA
GTGAGGAACATTTACCCCTGGTTCTTTGAGATGGCCTCCCTCGTCGCCGCAGCAGCCCTCGTGGCCGCCATCGTC
ATCATCCTAGTCGGGTTCGACGGAGAGAAACTCCCGCAATTGCCGTACAGCATCAATCTCAACACCATCATCGCT
CTGCTCACTCTCTGTCTTCGCGCTTCCATCGCGCTTATCGCGGCCGGAATAATCAGCCAATCGAAATGGATCTGG
TTCTCCGACAAGCCGCGCTCGCTGGCCAACTTCCAGACGTTCGACGAGGCTAGTCGTGGCTTGCTCGGCTCCCTC
AAGCTGATATCCCTCTTGCGTCTCAGCTGGCGCGGCAGTCCCTTGGCAGTCATGGCCGCCATCACATCCATCCTC
AGTCTAGCCATCAGTCCCTTCGCTCAGCAAGCCATCAAGACTTTACCTTGCCTCCGTGTTTCCTCATCTGACGGC
GCCAGGATCCCGGTGGCCATGCACCTCCCCGGCCCGGACGCATCGTCTACGGAATACACAATCCTGGATAACAGG
GCCCAAGGCGCCATCTTCTCAGGTATCACGAATCCGAGTGGCAACGAGAGCAATATACAGTCCTGGTGCCCAACC
GGTAACTGCACCTTTCCCGAGACGCTCGGTGTGCCGCACTCGACGATAGGGCTCTGTGCTCAGTGTTTGGACACA
ACTTCGCTTGTGAGAATCTCTCGACGACGCGACCCCGAAGACGGTGAGGAAACGACGGTGGCTTTGCTTAACGAC
ATGGTGCTTAGCGTCAAGCGTTTCTCACCCATGCTCATGGCGAAATCGCATGTTTATCCTGACAGCCTATCCTTC
GCAAGTTCTCTCATGACTCCCGGGTTCGAAAGTGCCGCTGAGAGTTCCGTTGCCAACGTCTCCGTCATGACATAC
ACCAGACTCAAAGGCGAACAATGTGCCGACGGCACCTTCAATGCGTCTTGTGTTGTGGCCGCTACCTGCTCGCTC
TATCTCTGCATGAAGAAGTTCAGAGCCAGCGTCGTCAACGGCCGGCTACAAGAATCCATCCTGGATGTAGTGCCG
TCTCAAGTCAACAGAACGGCCGACTTTGGGGATCACAATGAAGATCGTGCCATGATCAAGAGCCCTTGCCTAGTC
AATGGCCAACTGTATGACGAGACTAACTTCTCCTCCATACGAGCCGAGGACGTGACGGGAGGAGCCAGAACGATA
CCCGTCTTTGTCAAAAGAAGAGACTCTTCCCGCCGGACCAGAACGATAAAAATAGATGTGCCTTACGACTGCTTG
TATACCGTTGACGGCGACTACGTCTTCATGCTCGGACAATTCATGCAAGAAAGACTATTTTCCGGCTTCTGCAAC
GCTGGTAGGGGATATAAGGACAACGGAAACTTGGACTGCAACCGAACCTGGTGGCTTCACCAGTTCTACAATCGC
GGCAGCTCGTCCTACGACTTCATAAACAGGGCTGTCCAAGAGATGGCAACGGCTACGACCAATTACTTCCGGACA
GAGGCATGGACTCCCGATTATGACAGCGCATACAGCCATGTCACCCCCAACGTCACCGGCTACTCCAAAGCCTTC
ATCAGGGGCGAGATCCACCAAAGCAGCGTCTGCATGCGCCTCGACTGGCCCTGGCTTCTGCTCCCCGTGATACTC
TGCGTCGCGACGATAGTCCTCCTAGCCGCCATGCTGTTCGTCAACGCGAAACACAACCACCCACCCGTCTGGAAG
TCGAGCACGCTTCCGCTCTTGTTCTTTGGCCTCGACGGCCGGGGTTTGCAGAGAGAGGAGTCGTCGGATGGAGCG
TGTGCCGATGATCTAGCCAGTATGGGGCGTCAGGCGAAGCGGACGACGGCTTGTTTGGATGCAGATGGTGGATTG
TCCCGGACCGTCTTGGTGGCCTTGGATGGAACCGACTACGGAGACGGCAATGAGACGTTGAGTGAAGACATGTCG
TGA
Gene >Ophcf2|02857
ATGGATAATCAGCAGACGGCGTCCTCCTCAGACATAGAGCTACGGCTTGTAGAGGTCGACAATCAGCAGACGGCA
TCCTCCTCAGACACAGAGCTACGGCCTGCAGGGACCGGCAGCACGGCCAAGACTCAAAGACGACCATGGCAAAAA
GTGAGGAACATTTACCCCTGGTTCTTTGAGATGGCCTCCCTCGTCGCCGCAGCAGCCCTCGTGGCCGCCATCGTC
ATCATCCTAGTCGGGTTCGACGGAGAGAAACTCCCGCAATTGCCGTACAGCATCAATCTCAACACCATCATCGCT
CTGCTCACTCTCTGTCTTCGCGCTTCCATCGCGCTTATCGCGGCCGGAATAATCAGCCAATCGAAATGGATCTGG
TTCTCCGACAAGCCGCGCTCGCTGGCCAACTTCCAGACGTTCGACGAGGCTAGTCGTGGCTTGCTCGGCTCCCTC
AAGCTGATATCCCTCTTGCGTCTCAGCTGGCGCGGCAGTCCCTTGGCAGTCATGGCCGCCATCACATCCATCCTC
AGTCTAGCCATCAGTCCCTTCGCTCAGCAAGCCATCAAGACTTTACCTTGCCTCCGTGTTTCCTCATCTGACGGC
GCCAGGATCCCGGTGGCCATGCACCTCCCCGGCCCGGACGCATCGTCTACGGAATACACAATCCTGGATAACAGG
GCCCAAGGCGCCATCTTCTCAGGTATCACGAATCCGAGTGGCAACGAGAGCAATATACAGTCCTGGTGCCCAACC
GGTAACTGCACCTTTCCCGAGACGCTCGGTGTGCCGCACTCGACGATAGGGCTCTGTGCTCAGTGTTTGGACACA
ACTTCGCTTGTGAGAATCTCTCGACGACGCGACCCCGAAGACGGTGAGGAAACGACGGTGGCTTTGCTTAACGAC
ATGGTGCTTAGCGTCAAGCGTTTCTCACCCATGCTCATGGCGAAATCGCATGTTTATCCTGACAGCCTATCCTTC
GCAAGTTCTCTCATGACTCCCGGGTTCGAAAGTGCCGCTGAGAGTTCCGTTGCCAACGTCTCCGTCATGACATAC
ACCAGACTCAAAGGCGAACAATGTGCCGACGGCACCTTCAATGCGTCTTGTGTTGTGGCCGCTACCTGCTCGCTC
TATCTCTGCATGAAGAAGTTCAGAGCCAGCGTCGTCAACGGCCGGCTACAAGAATCCATCCTGGATGTAGTGCCG
TCTCAAGTCAACAGAACGGCCGACTTTGGGGATCACAATGAAGATCGTGCCATGATCAAGAGCCCTTGCCTAGTC
AATGGCCAACTGTATGACGAGACTAACTTCTCCTCCATACGAGCCGAGGACGTGACGGGAGGAGCCAGAACGATA
CCCGTCTTTGTCAAAAGAAGAGACTCTTCCCGCCGGACCAGAACGATAAAAATAGATGTGCCTTACGACTGCTTG
TATACCGTTGACGGCGACTACGTCTTCATGCTCGGACAATTCATGCAAGAAAGACTATTTTCCGGCTTCTGCAAC
GCTGGTAGGGGATATAAGGACAACGGAAACTTGGACTGCAACCGAACCTGGTGGCTTCACCAGTTCTACAATCGC
GGCAGCTCGTCCTACGACTTCATAAACAGGGCTGTCCAAGAGATGGCAACGGCTACGACCAATTACTTCCGGACA
GAGGCATGGACTCCCGATTATGACAGCGCATACAGCCATGTCACCCCCAACGTCACCGGCTACTCCAAAGCCTTC
ATCAGGGGCGAGATCCACCAAAGCAGCGTCTGCATGCGCCTCGACTGGCCCTGGCTTCTGCTCCCCGTGATACTC
TGCGTCGCGACGATAGTCCTCCTAGCCGCCATGCTGTTCGTCAACGCGAAACACAACCACCCACCCGTCTGGAAG
TCGAGCACGCTTCCGCTCTTGTTCTTTGGCCTCGACGGCCGGGGTTTGCAGAGAGAGGAGTCGTCGGATGGAGCG
TGTGCCGATGATCTAGCCAGTATGGGGCGTCAGGCGAAGCGGACGACGGCTTGTTTGGATGCAGATGGTGGATTG
TCCCGGACCGTCTTGGTGGCCTTGGATGGAACCGACTACGGAGACGGCAATGAGACGTTGAGTGAAGACATGTCG
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail