Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02856
Gene name
Locationscaffold_02:4947042..4951091
Strand-
Gene length (bp)4049
Transcript length (bp)3495
Coding sequence length (bp)3495
Protein length (aa) 1165

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12348 CLASP_N CLASP N terminal 3.0E-43 109 320
PF12348 CLASP_N CLASP N terminal 3.2E-89 380 605

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5471 0.5042 0.2121 0.1102 0.2269 0.0313 0.2757 0.1024 0.157 0.0517

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2404
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6556
Ophiocordyceps australis map64 (Brazil) OphauB2|4656
Ophiocordyceps camponoti-floridani Ophcf2|02856 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5233
Ophiocordyceps kimflemingae Ophio5|6457
Ophiocordyceps subramaniannii Hirsu2|3398

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02856
MNRTLLQTDGKPYCFVDRVFKINVTTRSLRVDFPLQTRHRPRAFFFSHSFRSDALRASYRRPPSTDDASPDAIPA
ATDPPSSLPETLTALHRDPFSTNSAEMADTKLTDQQVADLTALLRSDASFDVKVQRVTAVKSGIKQHNVPEASAP
LLFDGLRVASSSQHAALVNAGFTALNHLVTRLSRQEPRLLAKEAPRTLSVIIDRLGDHKDKFRALASQALTTLYL
VAPVDVERVIRNQAMVGKNSRAKEAAMQWLLQMHREQGLQFRAYVPLLMELLEDADGNVRDAAKSTVIELFKTAP
NAAKSDLKRQLKNFKVRPAIEQAIVKTLGPTGRPETPSDARPVNLTASVSSLTSDRATTPVTESPAEAVEPLYVN
THRELEDLFRGMTGHFDGKETEQNWLKREQSMSTLRKLMAGNAPADFADAFLTGLRAMLDGIIKAINSLRTSLSK
EGCGLVQDMAVTLGPAMDPMVELLMQTLVKLSAGTKKISSQLANVTVDTIIARVTYTGRLMQHVWAACQDKNVQP
RLYATGWLKTLLKKEGHHKNHVEHTGGVDMMEKCIKKGLGDANPGVREKMRSTYWAFWAVWPAKADAIMSDLDPT
AQKLLNKDPNNPNTPNKGTEAPRPGLGLSKSTMTAGKPSVREAMMAQRRANMAAKNLPPRPGSAMAHISPVRSTS
NSLAKTVPATTRTRQEATISVNAGGMSVAPMRPARRRPDVARPATAGPYSVREHPAMEAASPESAESTPRRAQEP
TPKRTTQRPRLAAVDTNGASSSSPRSASRIPSPRGSPPTRQARSATTGASPSVSPKAYEDLTMVVPEMPSIAATL
TRMKTADGQKTQSLEVTPVRSVPETEAEAHEETPSKEMKSPVSERLAKEIELPQEERPANKIKLPQEETPATTEP
TMTVPVLNDKPINEDAASISLPAPPQPQPPPPPSPRKARQNSRLLDSGINKIRTKTLEVHGFRKLQSLLRDARTP
VPDDKLQALVLALFSYLEDPLEGLPADKAQDVRAQMVATVKLVLNRDGEAFKPFVGRGVEALLTARSGYDVKAHV
VGGIELLASDLVSLADPPTLTTTLTTKLQSCPDESTPPTCRTLSMGLTLLRTLITPPLLLTPPPTRPLPNHDPRK
TMPLLAPFGREDGGGQAVRRPAPPPGRGPLLVLAGGRLG*
Coding >Ophcf2|02856
ATGAACAGGACTTTACTGCAGACAGATGGGAAACCCTATTGCTTCGTAGATCGGGTCTTCAAAATCAATGTCACC
ACCCGGTCCCTACGCGTCGACTTTCCTCTTCAAACGCGTCATCGGCCTCGCGCCTTCTTCTTCTCCCACTCGTTC
CGTTCCGACGCCCTCCGCGCATCGTATCGCAGACCTCCCTCAACAGACGACGCCTCTCCCGATGCGATCCCTGCC
GCCACCGATCCGCCGTCTTCGCTGCCCGAGACTCTGACAGCCCTTCACCGCGACCCCTTCTCCACAAATTCAGCA
GAAATGGCCGACACTAAGCTCACCGACCAGCAAGTCGCCGACCTGACCGCTCTCTTGCGCAGCGACGCCAGCTTC
GACGTCAAGGTCCAGCGCGTCACCGCCGTCAAATCCGGCATCAAGCAGCACAATGTTCCCGAGGCCAGCGCTCCC
CTCCTCTTCGACGGCCTGCGCGTCGCGTCCTCATCGCAGCATGCCGCCCTCGTAAATGCCGGCTTTACCGCCCTC
AACCATCTCGTCACCCGTCTCTCGCGTCAGGAGCCCCGTCTGCTCGCCAAAGAGGCGCCTCGTACGCTGTCCGTC
ATCATCGACAGGCTCGGCGACCACAAGGACAAGTTCCGCGCTCTGGCCTCTCAGGCCTTGACTACGCTCTATCTT
GTCGCTCCCGTCGACGTCGAGCGCGTCATCAGGAACCAGGCCATGGTCGGCAAGAACTCGAGGGCCAAGGAAGCG
GCCATGCAGTGGCTCTTGCAGATGCACCGCGAGCAAGGCCTGCAGTTTCGAGCTTACGTTCCTCTTCTCATGGAG
CTGCTCGAGGATGCCGACGGCAATGTTCGGGATGCTGCTAAGAGCACCGTCATCGAGCTGTTCAAGACCGCTCCC
AACGCCGCCAAGTCAGACCTAAAGCGGCAACTGAAAAACTTCAAGGTAAGACCTGCCATCGAGCAGGCCATCGTC
AAGACGCTCGGCCCTACCGGTCGACCGGAAACGCCCTCGGACGCCCGACCCGTGAATCTGACGGCCAGCGTATCC
TCCCTGACGAGCGATCGCGCGACCACGCCCGTGACCGAGTCTCCCGCCGAGGCCGTCGAGCCCCTATACGTCAAC
ACGCACCGCGAGCTCGAAGACTTGTTCCGCGGCATGACGGGCCACTTCGACGGCAAGGAGACGGAGCAGAACTGG
TTGAAGCGAGAGCAGTCCATGAGCACCCTACGCAAGCTCATGGCCGGAAACGCGCCGGCCGACTTCGCCGACGCC
TTTCTGACCGGACTGCGCGCCATGCTGGATGGCATCATCAAGGCCATCAACTCGCTGCGCACCAGCCTGTCCAAG
GAAGGCTGCGGCCTCGTCCAGGACATGGCGGTGACGCTGGGACCGGCCATGGATCCCATGGTCGAGCTCTTGATG
CAGACGCTCGTCAAGCTCTCGGCCGGCACCAAGAAGATCAGCTCGCAACTAGCAAACGTCACCGTCGACACCATC
ATCGCCCGCGTCACGTACACGGGCCGGCTGATGCAGCACGTCTGGGCCGCCTGTCAGGACAAGAACGTGCAGCCG
AGGCTGTATGCCACGGGCTGGCTCAAGACGCTCCTCAAGAAGGAGGGCCATCACAAGAACCACGTCGAGCATACG
GGTGGCGTCGATATGATGGAGAAGTGCATCAAGAAGGGCCTCGGCGATGCCAATCCCGGCGTGAGGGAGAAGATG
AGGTCGACCTACTGGGCCTTTTGGGCCGTGTGGCCAGCCAAAGCCGATGCCATCATGTCCGACCTGGACCCGACG
GCTCAGAAGCTCCTCAACAAGGACCCGAACAACCCCAACACTCCCAACAAGGGCACCGAAGCCCCCCGTCCGGGC
CTCGGCCTATCCAAGAGCACCATGACGGCCGGCAAGCCCAGCGTGCGCGAGGCCATGATGGCGCAGAGGAGGGCC
AACATGGCGGCCAAGAACCTGCCACCGCGTCCCGGATCGGCCATGGCGCACATTTCTCCCGTGCGCTCAACGTCC
AACTCGCTGGCCAAGACGGTCCCGGCGACTACGCGGACGCGCCAGGAGGCTACCATCTCGGTCAACGCCGGCGGC
ATGTCGGTGGCTCCAATGCGGCCTGCCAGGAGGAGGCCCGACGTGGCTCGACCGGCGACGGCTGGACCCTACTCG
GTGCGAGAGCATCCGGCCATGGAGGCCGCCAGCCCGGAGAGCGCCGAGTCTACGCCCAGGAGAGCCCAGGAGCCG
ACACCGAAGAGGACGACGCAGCGGCCGCGGCTGGCGGCGGTCGACACCAACGGCGCGTCGTCGTCATCGCCCAGG
TCGGCGTCTAGGATCCCGTCTCCTCGAGGGAGTCCGCCGACGAGGCAGGCTAGAAGCGCCACGACGGGCGCGTCT
CCCTCGGTGTCGCCCAAGGCGTACGAGGATCTGACCATGGTGGTGCCGGAGATGCCCAGCATAGCGGCGACGTTG
ACGCGCATGAAGACTGCTGATGGGCAGAAGACGCAGTCGCTGGAGGTGACGCCTGTGCGGTCTGTTCCGGAGACG
GAGGCCGAGGCTCACGAGGAGACGCCGTCCAAGGAGATGAAGTCGCCGGTCAGCGAGAGGCTGGCCAAGGAGATC
GAGTTGCCTCAGGAAGAGAGGCCGGCCAACAAGATCAAGCTCCCTCAGGAAGAGACGCCGGCCACAACAGAGCCA
ACCATGACCGTCCCCGTCCTAAACGACAAACCCATCAACGAAGACGCCGCGAGCATATCCCTCCCCGCCCCCCCC
CAGCCTCAACCTCCCCCCCCCCCTTCCCCCCGAAAAGCACGGCAAAACTCCCGCCTCCTCGACAGCGGCATCAAC
AAGATCAGAACGAAGACGCTAGAAGTCCACGGCTTCCGCAAGCTACAGTCCCTCCTCCGCGACGCCAGGACCCCC
GTCCCAGACGATAAGCTCCAGGCCCTCGTCCTCGCCCTCTTTTCCTACCTCGAAGATCCCCTCGAGGGCCTCCCA
GCGGACAAGGCGCAGGACGTGAGAGCCCAGATGGTGGCCACCGTCAAGCTCGTCCTCAACCGCGACGGCGAGGCC
TTCAAGCCCTTCGTCGGAAGGGGCGTCGAAGCCCTCCTAACCGCCCGCTCAGGCTACGACGTGAAAGCCCACGTC
GTCGGCGGCATCGAACTCCTAGCCTCGGACCTGGTCTCCCTAGCCGACCCCCCAACCCTAACCACGACCCTAACC
ACCAAGCTCCAATCCTGCCCCGACGAAAGCACACCCCCAACATGCCGCACCCTCTCCATGGGCCTCACCCTCCTC
CGAACCCTAATCACCCCTCCCCTCCTCCTCACCCCCCCCCCAACAAGACCTCTCCCCAACCATGACCCTCGCAAG
ACGATGCCTCTCCTCGCGCCATTCGGGCGTGAGGATGGAGGCGGTCAAGCTGTGCGTCGGCCTGCACCTCCGCCT
GGGCGAGGCCCTCTTCTGGTCCTCGCTGGGGGCCGTCTCGGATGA
Transcript >Ophcf2|02856
ATGAACAGGACTTTACTGCAGACAGATGGGAAACCCTATTGCTTCGTAGATCGGGTCTTCAAAATCAATGTCACC
ACCCGGTCCCTACGCGTCGACTTTCCTCTTCAAACGCGTCATCGGCCTCGCGCCTTCTTCTTCTCCCACTCGTTC
CGTTCCGACGCCCTCCGCGCATCGTATCGCAGACCTCCCTCAACAGACGACGCCTCTCCCGATGCGATCCCTGCC
GCCACCGATCCGCCGTCTTCGCTGCCCGAGACTCTGACAGCCCTTCACCGCGACCCCTTCTCCACAAATTCAGCA
GAAATGGCCGACACTAAGCTCACCGACCAGCAAGTCGCCGACCTGACCGCTCTCTTGCGCAGCGACGCCAGCTTC
GACGTCAAGGTCCAGCGCGTCACCGCCGTCAAATCCGGCATCAAGCAGCACAATGTTCCCGAGGCCAGCGCTCCC
CTCCTCTTCGACGGCCTGCGCGTCGCGTCCTCATCGCAGCATGCCGCCCTCGTAAATGCCGGCTTTACCGCCCTC
AACCATCTCGTCACCCGTCTCTCGCGTCAGGAGCCCCGTCTGCTCGCCAAAGAGGCGCCTCGTACGCTGTCCGTC
ATCATCGACAGGCTCGGCGACCACAAGGACAAGTTCCGCGCTCTGGCCTCTCAGGCCTTGACTACGCTCTATCTT
GTCGCTCCCGTCGACGTCGAGCGCGTCATCAGGAACCAGGCCATGGTCGGCAAGAACTCGAGGGCCAAGGAAGCG
GCCATGCAGTGGCTCTTGCAGATGCACCGCGAGCAAGGCCTGCAGTTTCGAGCTTACGTTCCTCTTCTCATGGAG
CTGCTCGAGGATGCCGACGGCAATGTTCGGGATGCTGCTAAGAGCACCGTCATCGAGCTGTTCAAGACCGCTCCC
AACGCCGCCAAGTCAGACCTAAAGCGGCAACTGAAAAACTTCAAGGTAAGACCTGCCATCGAGCAGGCCATCGTC
AAGACGCTCGGCCCTACCGGTCGACCGGAAACGCCCTCGGACGCCCGACCCGTGAATCTGACGGCCAGCGTATCC
TCCCTGACGAGCGATCGCGCGACCACGCCCGTGACCGAGTCTCCCGCCGAGGCCGTCGAGCCCCTATACGTCAAC
ACGCACCGCGAGCTCGAAGACTTGTTCCGCGGCATGACGGGCCACTTCGACGGCAAGGAGACGGAGCAGAACTGG
TTGAAGCGAGAGCAGTCCATGAGCACCCTACGCAAGCTCATGGCCGGAAACGCGCCGGCCGACTTCGCCGACGCC
TTTCTGACCGGACTGCGCGCCATGCTGGATGGCATCATCAAGGCCATCAACTCGCTGCGCACCAGCCTGTCCAAG
GAAGGCTGCGGCCTCGTCCAGGACATGGCGGTGACGCTGGGACCGGCCATGGATCCCATGGTCGAGCTCTTGATG
CAGACGCTCGTCAAGCTCTCGGCCGGCACCAAGAAGATCAGCTCGCAACTAGCAAACGTCACCGTCGACACCATC
ATCGCCCGCGTCACGTACACGGGCCGGCTGATGCAGCACGTCTGGGCCGCCTGTCAGGACAAGAACGTGCAGCCG
AGGCTGTATGCCACGGGCTGGCTCAAGACGCTCCTCAAGAAGGAGGGCCATCACAAGAACCACGTCGAGCATACG
GGTGGCGTCGATATGATGGAGAAGTGCATCAAGAAGGGCCTCGGCGATGCCAATCCCGGCGTGAGGGAGAAGATG
AGGTCGACCTACTGGGCCTTTTGGGCCGTGTGGCCAGCCAAAGCCGATGCCATCATGTCCGACCTGGACCCGACG
GCTCAGAAGCTCCTCAACAAGGACCCGAACAACCCCAACACTCCCAACAAGGGCACCGAAGCCCCCCGTCCGGGC
CTCGGCCTATCCAAGAGCACCATGACGGCCGGCAAGCCCAGCGTGCGCGAGGCCATGATGGCGCAGAGGAGGGCC
AACATGGCGGCCAAGAACCTGCCACCGCGTCCCGGATCGGCCATGGCGCACATTTCTCCCGTGCGCTCAACGTCC
AACTCGCTGGCCAAGACGGTCCCGGCGACTACGCGGACGCGCCAGGAGGCTACCATCTCGGTCAACGCCGGCGGC
ATGTCGGTGGCTCCAATGCGGCCTGCCAGGAGGAGGCCCGACGTGGCTCGACCGGCGACGGCTGGACCCTACTCG
GTGCGAGAGCATCCGGCCATGGAGGCCGCCAGCCCGGAGAGCGCCGAGTCTACGCCCAGGAGAGCCCAGGAGCCG
ACACCGAAGAGGACGACGCAGCGGCCGCGGCTGGCGGCGGTCGACACCAACGGCGCGTCGTCGTCATCGCCCAGG
TCGGCGTCTAGGATCCCGTCTCCTCGAGGGAGTCCGCCGACGAGGCAGGCTAGAAGCGCCACGACGGGCGCGTCT
CCCTCGGTGTCGCCCAAGGCGTACGAGGATCTGACCATGGTGGTGCCGGAGATGCCCAGCATAGCGGCGACGTTG
ACGCGCATGAAGACTGCTGATGGGCAGAAGACGCAGTCGCTGGAGGTGACGCCTGTGCGGTCTGTTCCGGAGACG
GAGGCCGAGGCTCACGAGGAGACGCCGTCCAAGGAGATGAAGTCGCCGGTCAGCGAGAGGCTGGCCAAGGAGATC
GAGTTGCCTCAGGAAGAGAGGCCGGCCAACAAGATCAAGCTCCCTCAGGAAGAGACGCCGGCCACAACAGAGCCA
ACCATGACCGTCCCCGTCCTAAACGACAAACCCATCAACGAAGACGCCGCGAGCATATCCCTCCCCGCCCCCCCC
CAGCCTCAACCTCCCCCCCCCCCTTCCCCCCGAAAAGCACGGCAAAACTCCCGCCTCCTCGACAGCGGCATCAAC
AAGATCAGAACGAAGACGCTAGAAGTCCACGGCTTCCGCAAGCTACAGTCCCTCCTCCGCGACGCCAGGACCCCC
GTCCCAGACGATAAGCTCCAGGCCCTCGTCCTCGCCCTCTTTTCCTACCTCGAAGATCCCCTCGAGGGCCTCCCA
GCGGACAAGGCGCAGGACGTGAGAGCCCAGATGGTGGCCACCGTCAAGCTCGTCCTCAACCGCGACGGCGAGGCC
TTCAAGCCCTTCGTCGGAAGGGGCGTCGAAGCCCTCCTAACCGCCCGCTCAGGCTACGACGTGAAAGCCCACGTC
GTCGGCGGCATCGAACTCCTAGCCTCGGACCTGGTCTCCCTAGCCGACCCCCCAACCCTAACCACGACCCTAACC
ACCAAGCTCCAATCCTGCCCCGACGAAAGCACACCCCCAACATGCCGCACCCTCTCCATGGGCCTCACCCTCCTC
CGAACCCTAATCACCCCTCCCCTCCTCCTCACCCCCCCCCCAACAAGACCTCTCCCCAACCATGACCCTCGCAAG
ACGATGCCTCTCCTCGCGCCATTCGGGCGTGAGGATGGAGGCGGTCAAGCTGTGCGTCGGCCTGCACCTCCGCCT
GGGCGAGGCCCTCTTCTGGTCCTCGCTGGGGGCCGTCTCGGATGA
Gene >Ophcf2|02856
ATGAACAGGACTTTACTGCAGACAGATGGGAAACCCTATTGCTTCGTAGATCGGGTCTTCAAAATCAATGTCACG
TGCATGATTTCCGACTACCCTATACCTGTTGCTCCATCCGGGGATCATCCGTTGACCAGGGCAACCAACAGCCTC
GGGCACTGACCACCAACGTCCATCCGCGTCCACCCGCGTCCATCAACGTCCATCCACAACCATCCACCCATCCAT
CCCATCTGACCCTCTTCAGCACCCGGTCCCTACGCGTCGACTTTCCTCTTCAAACGCGTCATCGGCCTCGCGCCT
TCTTCTTCTCCCACTCGTTCCGTTCCGACGCCCTCCGCGCATCGTATCGCAGACCTCCCTCAACAGACGACGCCT
CTCCCGATGCGATCCCTGCCGCCACCGATCCGCCGTCTTCGCTGCCCGAGACTCTGACAGCCCTTCACCGCGACC
CCTTCTCCACAAGTACGCCCTCCCGCCTTGTTTCACCTCTTCCGAACCTCGACTGACACGCGACGAGATTCAGCA
GAAATGGCCGACACTAAGCTCACCGACCAGCAAGTCGCCGACCTGACCGCTCTCTTGCGCAGCGACGCCAGCTTC
GACGTCAAGGTCCAGCGCGTCACCGCCGTCAAATCCGGCATCAAGCAGCACAATGTTCCCGAGGCCAGCGCTCCC
CTCCTCTTCGACGGCCTGCGCGTCGCGTCCTCATCGCAGCATGCCGCCCTCGTAAATGCCGGCTTTACCGCCCTC
AACCATCTCGTCACCCGTCTCTCGCGTCAGGAGCCCCGTCTGCTCGCCAAAGAGGCGCCTCGTACGCTGTCCGTC
ATCATCGACAGGCTCGGCGACCACAAGGACAAGTTCCGCGCTCTGGCCTCTCAGGCCTTGACTACGCTCTATCTT
GTCGCTCCCGTCGACGTCGAGCGCGTCATCAGGAACCAGGCCATGGTCGGCAAGAACTCGAGGGCCAAGGAAGCG
GCCATGCAGTGGCTCTTGCAGGTACCGTGCTCATCTAGTCGCTCCCTTGACATGCGACAGGAGAAGACTGACGCG
CATACCAACGCCGCTCAGATGCACCGCGAGCAAGGCCTGCAGTTTCGAGCTTACGTTCCTCTTCTCATGGAGCTG
CTCGAGGATGCCGACGGCAATGTTCGGGATGCTGCTAAGAGCACCGTCATCGAGCTGTTCAAGTGCGCCCTCCGT
CTACTCGAGACGGAATCAGCTGCTGACGACTTTCCAGGACCGCTCCCAACGCCGCCAAGTCAGACCTAAAGCGGC
AACTGAAAAACTTCAAGGTAAGACCTGCCATCGAGCAGGCCATCGTCAAGACGCTCGGCCCTACCGGTCGACCGG
AAACGCCCTCGGACGCCCGACCCGTGAATCTGACGGCCAGCGTATCCTCCCTGACGAGCGATCGCGCGACCACGC
CCGTGACCGAGTCTCCCGCCGAGGCCGTCGAGCCCCTATACGTCAACACGCACCGCGAGCTCGAAGACTTGTTCC
GCGGCATGACGGGCCACTTCGACGGCAAGGAGACGGAGCAGAACTGGTTGAAGCGAGAGCAGTCCATGAGCACCC
TACGCAAGCTCATGGCCGGAAACGCGCCGGCCGACTTCGCCGACGCCTTTCTGACCGGACTGCGCGCCATGCTGG
ATGGCATCATCAAGGCCATCAACTCGCTGCGCACCAGCCTGTCCAAGGAAGGCTGCGGCCTCGTCCAGGACATGG
CGGTGACGCTGGGACCGGCCATGGATCCCATGGTCGAGCTCTTGATGCAGACGCTCGTCAAGCTCTCGGCCGGCA
CCAAGAAGATCAGCTCGCAACTAGCAAACGTCACCGTCGACACCATCATCGCCCGCGTCACGTACACGGGCCGGC
TGATGCAGCACGTCTGGGCCGCCTGTCAGGACAAGAACGTGCAGCCGAGGCTGTATGCCACGGGCTGGCTCAAGA
CGCTCCTCAAGAAGGAGGGCCATCACAAGAACCACGTCGAGCATACGGGTGGCGTCGATATGATGGAGAAGTGCA
TCAAGAAGGGCCTCGGCGATGCCAATCCCGGCGTGAGGGAGAAGATGAGGTCGACCTACTGGGCCTTTTGGGCCG
TGTGGCCAGCCAAAGCCGATGCGTACGGTTTCCCTTTCTCTTCTTGTGAAAGCCATGACAGCTAACAGTCATGTA
TAGCATCATGTCCGACCTGGACCCGACGGCTCAGAAGCTCCTCAACAAGGACCCGAACAACCCCAACACTCCCAA
CAAGGGCACCGAAGCCCCCCGTCCGGGCCTCGGCCTATCCAAGAGCACCATGACGGCCGGCAAGCCCAGCGTGCG
CGAGGCCATGATGGCGCAGAGGAGGGCCAACATGGCGGCCAAGAACCTGCCACCGCGTCCCGGATCGGCCATGGC
GCACATTTCTCCCGTGCGCTCAACGTCCAACTCGCTGGCCAAGACGGTCCCGGCGACTACGCGGACGCGCCAGGA
GGCTACCATCTCGGTCAACGCCGGCGGCATGTCGGTGGCTCCAATGCGGCCTGCCAGGAGGAGGCCCGACGTGGC
TCGACCGGCGACGGCTGGACCCTACTCGGTGCGAGAGCATCCGGCCATGGAGGCCGCCAGCCCGGAGAGCGCCGA
GTCTACGCCCAGGAGAGCCCAGGAGCCGACACCGAAGAGGACGACGCAGCGGCCGCGGCTGGCGGCGGTCGACAC
CAACGGCGCGTCGTCGTCATCGCCCAGGTCGGCGTCTAGGATCCCGTCTCCTCGAGGGAGTCCGCCGACGAGGCA
GGCTAGAAGCGCCACGACGGGCGCGTCTCCCTCGGTGTCGCCCAAGGCGTACGAGGATCTGACCATGGTGGTGCC
GGAGATGCCCAGCATAGCGGCGACGTTGACGCGCATGAAGACTGCTGATGGGCAGAAGACGCAGTCGCTGGAGGT
GACGCCTGTGCGGTCTGTTCCGGAGACGGAGGCCGAGGCTCACGAGGAGACGCCGTCCAAGGAGATGAAGTCGCC
GGTCAGCGAGAGGCTGGCCAAGGAGATCGAGTTGCCTCAGGAAGAGAGGCCGGCCAACAAGATCAAGCTCCCTCA
GGAAGAGACGCCGGCCACAACAGAGGTCAAGCCCCTTGAGACAGAGACCCCCCCCAAAGATGCATCCCCATCCAA
AGAGCAACACCCCCGAACCCACCATCAGACACGCAACTATCATCGCAGAGCGCCCTCAAAGTCTTCGAAGACCCC
TTCAAAGAAGAACAGCCCCCCCAAAGCCAACCATGACCGTCCCCGTCCTAAACGACAAACCCATCAACGAAGACG
CCGCGAGCATATCCCTCCCCGCCCCCCCCCAGCCTCAACCTCCCCCCCCCCCTTCCCCCCGAAAAGCACGGCAAA
ACTCCCGCCTCCTCGACAGCGGCATCAACAAGATCAGAACGAAGACGCTAGAAGTCCACGGCTTCCGCAAGCTAC
AGTCCCTCCTCCGCGACGCCAGGACCCCCGTCCCAGACGATAAGCTCCAGGCCCTCGTCCTCGCCCTCTTTTCCT
ACCTCGAAGATCCCCTCGAGGGCCTCCCAGCGGACAAGGCGCAGGACGTGAGAGCCCAGATGGTGGCCACCGTCA
AGCTCGTCCTCAACCGCGACGGCGAGGCCTTCAAGCCCTTCGTCGGAAGGGGCGTCGAAGCCCTCCTAACCGCCC
GCTCAGGCTACGACGTGAAAGCCCACGTCGTCGGCGGCATCGAACTCCTAGCCTCGGACCTGGTCTCCCTAGCCG
ACCCCCCAACCCTAACCACGACCCTAACCACCAAGCTCCAATCCTGCCCCGACGAAAGCACACCCCCAACATGCC
GCACCCTCTCCATGGGCCTCACCCTCCTCCGAACCCTAATCACCCCTCCCCTCCTCCTCACCCCCCCCCCAACAA
GACCTCTCCCCAACCATGACCCTCGCAAGACGATGCCTCTCCTCGCGCCATTCGGGCGTGAGGATGGAGGCGGTC
AAGCTGTGCGTCGGCCTGCACCTCCGCCTGGGCGAGGCCCTCTTCTGGTCCTCGCTGGGGGCCGTCTCGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail