Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02852
Gene name
Locationscaffold_02:4937282..4939574
Strand-
Gene length (bp)2292
Transcript length (bp)2292
Coding sequence length (bp)2292
Protein length (aa) 764

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13915 DUF4210 Domain of unknown function (DUF4210) 1.1E-33 338 412
PF13889 Chromosome_seg Chromosome segregation during meiosis 1.8E-22 548 600

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear export signal 0.4151 0.5147 0.0098 0.0829 0.0666 0.0045 0.1641 0.3902 0.3345 0.0093

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5893
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7240
Ophiocordyceps australis map64 (Brazil) OphauB2|4659
Ophiocordyceps camponoti-floridani Ophcf2|02852 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|748
Ophiocordyceps kimflemingae Ophio5|4070

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02852
MPIFQADLDSGGRRRQPPAIDIGPVSPRLRREGLSDAHRRPEVDGTATSDRSELIQRLKRGESPTWIPNRLARAC
KPVPQLRNDDDDDDDDDDDDDEDDDDDDEDEPPLDSILPNTDTEDDSSAPAQPGHRFPAQMAHDGASIEHPRPAL
HTGDFTHNVAHDDTPRKIVGRVERKSTHGSWIATSPPRDFAPYRHEHRRQLTDSAACFVSGPSPLSSSLSSSFAY
QPPTSPLVQSESHDDLDFSMPMSLSQRDSADMGLGASPFSSAAAASAWRQAERRRDSLPCQAHQPRRCLTTTMPT
TSTPGFPHNGSSPQTPAMLRSRRPSIGSDLSPIQHASMVGSYEESILRGRMSTTPSKPFDFLAQIGVLGKGKCRS
SLRCPSHVTLPFPAVYYSYGGTANGLPRDDDGPSPYVGQIDLENGLPNVKDESRSRRKLKARYLDRGSATKTDGD
AETDTAPTGSDSRRTRYTKRRRSASPRAPPGGSYRIPEKGQVQMVIKNQNKTAVKLFLVPYDLTGMEAGTKTFIR
QRSYSAGPMMSHEARPSDDKRPMLRYLVHLHICCPSRGRFYLYKSIRVVFANRCPDGKEKLRNDTTWPEPRFSPY
KPIRLMHPPAASLSAGPAALLAADKALRRRSLGIAFGPSSLSSPSARVSSPAGNTLPVDPVAYNLVPPFRLYSES
DSPLDSPSRPSSSSTTETATDTSNNTNPNDGPPSIAPPIPPPSTMGSNPLREAQPRRRRIRRLRTGITPPGRDGG
SPLPTTTMLQHTE*
Coding >Ophcf2|02852
ATGCCCATCTTTCAGGCCGATCTCGACTCTGGCGGTCGCCGTCGCCAGCCGCCGGCCATCGATATCGGGCCCGTC
TCTCCCCGGCTGCGCCGCGAGGGTCTCTCGGACGCCCACAGACGGCCTGAAGTCGATGGCACGGCTACTTCGGAC
CGTAGCGAGTTGATTCAGCGTCTCAAGAGAGGCGAGAGCCCGACCTGGATCCCGAATCGACTGGCAAGAGCCTGC
AAGCCCGTGCCTCAACTCCGGAACGACGACGACGACGACGATGACGACGACGACGACGACGACGAAGACGACGAC
GACGATGATGAAGACGAGCCGCCGCTCGACTCCATTCTCCCCAATACCGATACCGAGGACGACTCGTCTGCTCCC
GCTCAGCCCGGCCACCGTTTTCCTGCTCAGATGGCCCATGACGGAGCCAGCATCGAGCATCCTCGGCCCGCCCTT
CACACCGGCGACTTCACCCACAACGTCGCCCATGACGATACGCCACGCAAGATCGTCGGCCGTGTCGAGAGAAAG
TCAACACACGGCTCGTGGATCGCCACCTCGCCCCCCCGCGACTTCGCCCCTTACCGCCACGAGCATCGGAGACAG
CTGACGGACAGCGCGGCGTGCTTCGTCTCGGGCCCGTCTCCCCTGTCTTCTTCCCTGTCCTCCAGTTTCGCCTAT
CAACCGCCGACGAGCCCGCTGGTGCAGTCGGAGAGCCACGACGATCTCGACTTCTCCATGCCCATGTCGTTGAGC
CAGCGAGACTCGGCCGACATGGGACTCGGCGCTTCGCCCTTTTCTTCGGCCGCCGCAGCTTCGGCCTGGCGCCAG
GCCGAGCGACGCAGAGACTCGCTGCCGTGTCAAGCGCATCAGCCGCGGAGGTGCCTGACGACGACGATGCCGACG
ACGTCGACGCCCGGCTTCCCGCACAACGGCTCGTCGCCGCAGACACCGGCCATGCTCCGCTCGAGGCGGCCGTCG
ATCGGATCAGACCTGTCTCCCATCCAGCACGCGTCCATGGTCGGATCGTACGAGGAGAGCATCCTCCGCGGACGC
ATGTCGACGACGCCATCCAAGCCCTTTGACTTTCTGGCCCAGATTGGCGTCTTAGGCAAAGGCAAATGCAGATCA
AGCCTCCGGTGCCCGTCACATGTCACGCTACCCTTTCCCGCCGTCTACTACAGCTACGGCGGCACAGCCAACGGC
CTACCACGCGATGACGACGGTCCGAGCCCCTACGTCGGCCAGATCGACCTGGAGAATGGGCTGCCCAACGTCAAG
GACGAGTCACGTTCGCGCAGGAAGCTCAAGGCGCGCTATCTAGACAGAGGCTCGGCCACCAAGACAGACGGCGAT
GCGGAGACGGACACGGCGCCGACCGGCTCGGACTCTCGGCGGACGCGCTACACCAAGAGACGTCGATCTGCTTCT
CCCCGGGCACCCCCCGGCGGCAGCTACAGGATCCCGGAAAAGGGACAGGTGCAAATGGTGATCAAGAATCAGAAC
AAGACGGCCGTCAAGCTCTTCTTGGTACCATACGACCTGACGGGCATGGAAGCCGGCACCAAGACCTTCATCCGT
CAGCGCAGCTATTCGGCAGGGCCCATGATGTCGCACGAAGCGCGACCAAGCGACGACAAGAGACCAATGCTACGA
TATCTCGTGCATCTACACATCTGCTGTCCTTCGCGCGGCCGCTTCTACCTCTACAAGAGCATCCGCGTCGTCTTC
GCGAACCGCTGTCCAGATGGAAAGGAGAAGCTGCGTAACGATACGACGTGGCCCGAGCCTCGATTCTCCCCCTAT
AAACCCATTCGACTCATGCACCCACCCGCAGCCTCGCTCTCTGCCGGACCAGCCGCTCTACTGGCAGCGGATAAG
GCGCTCCGTCGTCGCAGCCTCGGCATCGCCTTCGGTCCCTCGTCTCTATCATCGCCTTCCGCGCGCGTCTCGTCT
CCCGCCGGAAATACCCTACCCGTCGATCCCGTCGCCTACAACCTCGTGCCGCCATTCCGCCTCTACAGCGAAAGC
GACTCCCCTCTCGACTCCCCCAGCCGTCCCTCATCCTCATCGACTACAGAAACAGCAACGGACACCAGCAACAAC
ACCAACCCCAACGACGGCCCTCCGAGCATCGCACCGCCCATCCCGCCCCCCTCCACCATGGGGTCCAACCCGCTA
CGAGAAGCTCAGCCGCGGCGACGCAGGATACGGCGGCTGCGGACCGGAATCACCCCCCCAGGGCGCGACGGAGGG
TCTCCTCTCCCAACGACTACGATGCTTCAACATACGGAATAG
Transcript >Ophcf2|02852
ATGCCCATCTTTCAGGCCGATCTCGACTCTGGCGGTCGCCGTCGCCAGCCGCCGGCCATCGATATCGGGCCCGTC
TCTCCCCGGCTGCGCCGCGAGGGTCTCTCGGACGCCCACAGACGGCCTGAAGTCGATGGCACGGCTACTTCGGAC
CGTAGCGAGTTGATTCAGCGTCTCAAGAGAGGCGAGAGCCCGACCTGGATCCCGAATCGACTGGCAAGAGCCTGC
AAGCCCGTGCCTCAACTCCGGAACGACGACGACGACGACGATGACGACGACGACGACGACGACGAAGACGACGAC
GACGATGATGAAGACGAGCCGCCGCTCGACTCCATTCTCCCCAATACCGATACCGAGGACGACTCGTCTGCTCCC
GCTCAGCCCGGCCACCGTTTTCCTGCTCAGATGGCCCATGACGGAGCCAGCATCGAGCATCCTCGGCCCGCCCTT
CACACCGGCGACTTCACCCACAACGTCGCCCATGACGATACGCCACGCAAGATCGTCGGCCGTGTCGAGAGAAAG
TCAACACACGGCTCGTGGATCGCCACCTCGCCCCCCCGCGACTTCGCCCCTTACCGCCACGAGCATCGGAGACAG
CTGACGGACAGCGCGGCGTGCTTCGTCTCGGGCCCGTCTCCCCTGTCTTCTTCCCTGTCCTCCAGTTTCGCCTAT
CAACCGCCGACGAGCCCGCTGGTGCAGTCGGAGAGCCACGACGATCTCGACTTCTCCATGCCCATGTCGTTGAGC
CAGCGAGACTCGGCCGACATGGGACTCGGCGCTTCGCCCTTTTCTTCGGCCGCCGCAGCTTCGGCCTGGCGCCAG
GCCGAGCGACGCAGAGACTCGCTGCCGTGTCAAGCGCATCAGCCGCGGAGGTGCCTGACGACGACGATGCCGACG
ACGTCGACGCCCGGCTTCCCGCACAACGGCTCGTCGCCGCAGACACCGGCCATGCTCCGCTCGAGGCGGCCGTCG
ATCGGATCAGACCTGTCTCCCATCCAGCACGCGTCCATGGTCGGATCGTACGAGGAGAGCATCCTCCGCGGACGC
ATGTCGACGACGCCATCCAAGCCCTTTGACTTTCTGGCCCAGATTGGCGTCTTAGGCAAAGGCAAATGCAGATCA
AGCCTCCGGTGCCCGTCACATGTCACGCTACCCTTTCCCGCCGTCTACTACAGCTACGGCGGCACAGCCAACGGC
CTACCACGCGATGACGACGGTCCGAGCCCCTACGTCGGCCAGATCGACCTGGAGAATGGGCTGCCCAACGTCAAG
GACGAGTCACGTTCGCGCAGGAAGCTCAAGGCGCGCTATCTAGACAGAGGCTCGGCCACCAAGACAGACGGCGAT
GCGGAGACGGACACGGCGCCGACCGGCTCGGACTCTCGGCGGACGCGCTACACCAAGAGACGTCGATCTGCTTCT
CCCCGGGCACCCCCCGGCGGCAGCTACAGGATCCCGGAAAAGGGACAGGTGCAAATGGTGATCAAGAATCAGAAC
AAGACGGCCGTCAAGCTCTTCTTGGTACCATACGACCTGACGGGCATGGAAGCCGGCACCAAGACCTTCATCCGT
CAGCGCAGCTATTCGGCAGGGCCCATGATGTCGCACGAAGCGCGACCAAGCGACGACAAGAGACCAATGCTACGA
TATCTCGTGCATCTACACATCTGCTGTCCTTCGCGCGGCCGCTTCTACCTCTACAAGAGCATCCGCGTCGTCTTC
GCGAACCGCTGTCCAGATGGAAAGGAGAAGCTGCGTAACGATACGACGTGGCCCGAGCCTCGATTCTCCCCCTAT
AAACCCATTCGACTCATGCACCCACCCGCAGCCTCGCTCTCTGCCGGACCAGCCGCTCTACTGGCAGCGGATAAG
GCGCTCCGTCGTCGCAGCCTCGGCATCGCCTTCGGTCCCTCGTCTCTATCATCGCCTTCCGCGCGCGTCTCGTCT
CCCGCCGGAAATACCCTACCCGTCGATCCCGTCGCCTACAACCTCGTGCCGCCATTCCGCCTCTACAGCGAAAGC
GACTCCCCTCTCGACTCCCCCAGCCGTCCCTCATCCTCATCGACTACAGAAACAGCAACGGACACCAGCAACAAC
ACCAACCCCAACGACGGCCCTCCGAGCATCGCACCGCCCATCCCGCCCCCCTCCACCATGGGGTCCAACCCGCTA
CGAGAAGCTCAGCCGCGGCGACGCAGGATACGGCGGCTGCGGACCGGAATCACCCCCCCAGGGCGCGACGGAGGG
TCTCCTCTCCCAACGACTACGATGCTTCAACATACGGAATAG
Gene >Ophcf2|02852
ATGCCCATCTTTCAGGCCGATCTCGACTCTGGCGGTCGCCGTCGCCAGCCGCCGGCCATCGATATCGGGCCCGTC
TCTCCCCGGCTGCGCCGCGAGGGTCTCTCGGACGCCCACAGACGGCCTGAAGTCGATGGCACGGCTACTTCGGAC
CGTAGCGAGTTGATTCAGCGTCTCAAGAGAGGCGAGAGCCCGACCTGGATCCCGAATCGACTGGCAAGAGCCTGC
AAGCCCGTGCCTCAACTCCGGAACGACGACGACGACGACGATGACGACGACGACGACGACGACGAAGACGACGAC
GACGATGATGAAGACGAGCCGCCGCTCGACTCCATTCTCCCCAATACCGATACCGAGGACGACTCGTCTGCTCCC
GCTCAGCCCGGCCACCGTTTTCCTGCTCAGATGGCCCATGACGGAGCCAGCATCGAGCATCCTCGGCCCGCCCTT
CACACCGGCGACTTCACCCACAACGTCGCCCATGACGATACGCCACGCAAGATCGTCGGCCGTGTCGAGAGAAAG
TCAACACACGGCTCGTGGATCGCCACCTCGCCCCCCCGCGACTTCGCCCCTTACCGCCACGAGCATCGGAGACAG
CTGACGGACAGCGCGGCGTGCTTCGTCTCGGGCCCGTCTCCCCTGTCTTCTTCCCTGTCCTCCAGTTTCGCCTAT
CAACCGCCGACGAGCCCGCTGGTGCAGTCGGAGAGCCACGACGATCTCGACTTCTCCATGCCCATGTCGTTGAGC
CAGCGAGACTCGGCCGACATGGGACTCGGCGCTTCGCCCTTTTCTTCGGCCGCCGCAGCTTCGGCCTGGCGCCAG
GCCGAGCGACGCAGAGACTCGCTGCCGTGTCAAGCGCATCAGCCGCGGAGGTGCCTGACGACGACGATGCCGACG
ACGTCGACGCCCGGCTTCCCGCACAACGGCTCGTCGCCGCAGACACCGGCCATGCTCCGCTCGAGGCGGCCGTCG
ATCGGATCAGACCTGTCTCCCATCCAGCACGCGTCCATGGTCGGATCGTACGAGGAGAGCATCCTCCGCGGACGC
ATGTCGACGACGCCATCCAAGCCCTTTGACTTTCTGGCCCAGATTGGCGTCTTAGGCAAAGGCAAATGCAGATCA
AGCCTCCGGTGCCCGTCACATGTCACGCTACCCTTTCCCGCCGTCTACTACAGCTACGGCGGCACAGCCAACGGC
CTACCACGCGATGACGACGGTCCGAGCCCCTACGTCGGCCAGATCGACCTGGAGAATGGGCTGCCCAACGTCAAG
GACGAGTCACGTTCGCGCAGGAAGCTCAAGGCGCGCTATCTAGACAGAGGCTCGGCCACCAAGACAGACGGCGAT
GCGGAGACGGACACGGCGCCGACCGGCTCGGACTCTCGGCGGACGCGCTACACCAAGAGACGTCGATCTGCTTCT
CCCCGGGCACCCCCCGGCGGCAGCTACAGGATCCCGGAAAAGGGACAGGTGCAAATGGTGATCAAGAATCAGAAC
AAGACGGCCGTCAAGCTCTTCTTGGTACCATACGACCTGACGGGCATGGAAGCCGGCACCAAGACCTTCATCCGT
CAGCGCAGCTATTCGGCAGGGCCCATGATGTCGCACGAAGCGCGACCAAGCGACGACAAGAGACCAATGCTACGA
TATCTCGTGCATCTACACATCTGCTGTCCTTCGCGCGGCCGCTTCTACCTCTACAAGAGCATCCGCGTCGTCTTC
GCGAACCGCTGTCCAGATGGAAAGGAGAAGCTGCGTAACGATACGACGTGGCCCGAGCCTCGATTCTCCCCCTAT
AAACCCATTCGACTCATGCACCCACCCGCAGCCTCGCTCTCTGCCGGACCAGCCGCTCTACTGGCAGCGGATAAG
GCGCTCCGTCGTCGCAGCCTCGGCATCGCCTTCGGTCCCTCGTCTCTATCATCGCCTTCCGCGCGCGTCTCGTCT
CCCGCCGGAAATACCCTACCCGTCGATCCCGTCGCCTACAACCTCGTGCCGCCATTCCGCCTCTACAGCGAAAGC
GACTCCCCTCTCGACTCCCCCAGCCGTCCCTCATCCTCATCGACTACAGAAACAGCAACGGACACCAGCAACAAC
ACCAACCCCAACGACGGCCCTCCGAGCATCGCACCGCCCATCCCGCCCCCCTCCACCATGGGGTCCAACCCGCTA
CGAGAAGCTCAGCCGCGGCGACGCAGGATACGGCGGCTGCGGACCGGAATCACCCCCCCAGGGCGCGACGGAGGG
TCTCCTCTCCCAACGACTACGATGCTTCAACATACGGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail