Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02846
Gene name
Locationscaffold_02:4921691..4922733
Strand+
Gene length (bp)1042
Transcript length (bp)984
Coding sequence length (bp)984
Protein length (aa) 328

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04143 Sulf_transp Sulphur transport 2.0E-25 27 319

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 39 56 17
3 81 103 22
4 107 129 22
5 158 180 22
6 185 204 19
7 242 264 22
8 274 296 22
9 303 325 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02846
MAASAAVSGAVFGAAMATAGFHDGSLIVAQMKLQSWHMLQAFMVATASSAIIYCLVERRLHLVIPPRPASSLGIF
ASHDGNVIGGALLGVGIVLSGSCPGALFAQLAAGGRTACFTLAGAVAGAVIWAGKAGELVRRRQQKSDPGLGMQG
PHLSRAKGLLLLETTCLAVLALSVSLAPSIPGGRVNGAVAGLVIGIAQLVSLLARRSMLGACGPYREAGALLRRL
ICGSRLDTKPGDDGSKMAFGLGAVAGAWLLLRAAPSLVADAVFEAPPLFATVGGFLMVVGAALAGGCTSGHGISG
ISLLSASSIVTMASVFAAGTTVAALTY*
Coding >Ophcf2|02846
ATGGCCGCTTCCGCCGCCGTCTCGGGCGCCGTCTTCGGAGCCGCCATGGCCACTGCCGGCTTTCACGACGGCTCC
CTCATCGTGGCTCAGATGAAGCTCCAGAGCTGGCATATGCTTCAAGCCTTTATGGTTGCCACGGCAAGCAGCGCT
ATCATATACTGTCTTGTCGAGAGGCGACTTCACCTTGTCATACCGCCGCGTCCCGCCTCTTCTCTGGGAATCTTT
GCCAGCCACGACGGAAACGTCATCGGCGGCGCCCTGCTTGGGGTTGGAATTGTCCTCTCCGGCTCCTGTCCAGGC
GCCTTATTCGCTCAGCTTGCGGCCGGGGGTCGGACTGCCTGCTTCACTCTGGCAGGTGCCGTCGCCGGCGCCGTC
ATATGGGCCGGTAAAGCCGGCGAGCTGGTCCGCCGTCGGCAGCAGAAATCGGACCCGGGGCTTGGCATGCAGGGG
CCACACCTTTCGAGGGCCAAGGGGCTGCTTCTTCTCGAGACAACCTGCCTGGCCGTCTTGGCCCTGTCGGTCAGC
CTGGCGCCGTCTATCCCAGGCGGCCGAGTGAATGGAGCCGTGGCCGGTCTAGTCATCGGCATCGCACAGCTCGTT
TCGCTCCTGGCGCGACGGTCCATGCTGGGTGCATGCGGCCCGTACCGAGAAGCTGGCGCTTTGCTGCGGCGCCTG
ATTTGCGGCTCGAGGCTCGACACAAAGCCGGGTGATGATGGCTCAAAGATGGCCTTTGGCCTGGGCGCCGTTGCC
GGTGCCTGGCTGCTCCTGCGAGCAGCTCCGTCTCTGGTCGCCGACGCCGTCTTCGAGGCCCCGCCCCTGTTTGCC
ACCGTCGGCGGCTTTCTCATGGTCGTCGGAGCAGCTCTGGCGGGCGGGTGCACGTCCGGACATGGCATCAGCGGC
ATCTCACTGCTCTCGGCGTCTAGCATCGTGACCATGGCCAGTGTCTTTGCTGCGGGCACAACAGTGGCGGCGCTG
ACGTACTAG
Transcript >Ophcf2|02846
ATGGCCGCTTCCGCCGCCGTCTCGGGCGCCGTCTTCGGAGCCGCCATGGCCACTGCCGGCTTTCACGACGGCTCC
CTCATCGTGGCTCAGATGAAGCTCCAGAGCTGGCATATGCTTCAAGCCTTTATGGTTGCCACGGCAAGCAGCGCT
ATCATATACTGTCTTGTCGAGAGGCGACTTCACCTTGTCATACCGCCGCGTCCCGCCTCTTCTCTGGGAATCTTT
GCCAGCCACGACGGAAACGTCATCGGCGGCGCCCTGCTTGGGGTTGGAATTGTCCTCTCCGGCTCCTGTCCAGGC
GCCTTATTCGCTCAGCTTGCGGCCGGGGGTCGGACTGCCTGCTTCACTCTGGCAGGTGCCGTCGCCGGCGCCGTC
ATATGGGCCGGTAAAGCCGGCGAGCTGGTCCGCCGTCGGCAGCAGAAATCGGACCCGGGGCTTGGCATGCAGGGG
CCACACCTTTCGAGGGCCAAGGGGCTGCTTCTTCTCGAGACAACCTGCCTGGCCGTCTTGGCCCTGTCGGTCAGC
CTGGCGCCGTCTATCCCAGGCGGCCGAGTGAATGGAGCCGTGGCCGGTCTAGTCATCGGCATCGCACAGCTCGTT
TCGCTCCTGGCGCGACGGTCCATGCTGGGTGCATGCGGCCCGTACCGAGAAGCTGGCGCTTTGCTGCGGCGCCTG
ATTTGCGGCTCGAGGCTCGACACAAAGCCGGGTGATGATGGCTCAAAGATGGCCTTTGGCCTGGGCGCCGTTGCC
GGTGCCTGGCTGCTCCTGCGAGCAGCTCCGTCTCTGGTCGCCGACGCCGTCTTCGAGGCCCCGCCCCTGTTTGCC
ACCGTCGGCGGCTTTCTCATGGTCGTCGGAGCAGCTCTGGCGGGCGGGTGCACGTCCGGACATGGCATCAGCGGC
ATCTCACTGCTCTCGGCGTCTAGCATCGTGACCATGGCCAGTGTCTTTGCTGCGGGCACAACAGTGGCGGCGCTG
ACGTACTAG
Gene >Ophcf2|02846
ATGGCCGCTTCCGCCGCCGTCTCGGGCGCCGTCTTCGGAGCCGCCATGGCCACTGCCGGCTTTCACGACGGCTCC
CTCATCGTGGCTCAGATGAAGCTCCAGAGCTGGCATATGCTTCAAGCCTTTATGGTTGCCACGGCAAGCAGCGCG
TGAGGCTTCCCCAAGGAAACCGTACCTCCTAAAGAGTCTTGGTAACCTTCGTTGCAGTATCATATACTGTCTTGT
CGAGAGGCGACTTCACCTTGTCATACCGCCGCGTCCCGCCTCTTCTCTGGGAATCTTTGCCAGCCACGACGGAAA
CGTCATCGGCGGCGCCCTGCTTGGGGTTGGAATTGTCCTCTCCGGCTCCTGTCCAGGCGCCTTATTCGCTCAGCT
TGCGGCCGGGGGTCGGACTGCCTGCTTCACTCTGGCAGGTGCCGTCGCCGGCGCCGTCATATGGGCCGGTAAAGC
CGGCGAGCTGGTCCGCCGTCGGCAGCAGAAATCGGACCCGGGGCTTGGCATGCAGGGGCCACACCTTTCGAGGGC
CAAGGGGCTGCTTCTTCTCGAGACAACCTGCCTGGCCGTCTTGGCCCTGTCGGTCAGCCTGGCGCCGTCTATCCC
AGGCGGCCGAGTGAATGGAGCCGTGGCCGGTCTAGTCATCGGCATCGCACAGCTCGTTTCGCTCCTGGCGCGACG
GTCCATGCTGGGTGCATGCGGCCCGTACCGAGAAGCTGGCGCTTTGCTGCGGCGCCTGATTTGCGGCTCGAGGCT
CGACACAAAGCCGGGTGATGATGGCTCAAAGATGGCCTTTGGCCTGGGCGCCGTTGCCGGTGCCTGGCTGCTCCT
GCGAGCAGCTCCGTCTCTGGTCGCCGACGCCGTCTTCGAGGCCCCGCCCCTGTTTGCCACCGTCGGCGGCTTTCT
CATGGTCGTCGGAGCAGCTCTGGCGGGCGGGTGCACGTCCGGACATGGCATCAGCGGCATCTCACTGCTCTCGGC
GTCTAGCATCGTGACCATGGCCAGTGTCTTTGCTGCGGGCACAACAGTGGCGGCGCTGACGTACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail