Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02835
Gene name
Locationscaffold_02:4897001..4898280
Strand-
Gene length (bp)1279
Transcript length (bp)1149
Coding sequence length (bp)1149
Protein length (aa) 383

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00535 Glycos_transf_2 Glycosyl transferase family 2 2.5E-23 90 224
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 9.6E-08 140 207

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 22.15 10.37 33.92
Alive In ants, during behavior modification 15.11 6.32 23.90
Dead In ants, recently dead 11.03 4.21 17.85

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.119912 no
Alive Dead 0.169617 no
Dead Fungus 0.003749 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02835
MECLRQLAAPKNLALGCVLGLLVLFGLFLVLHLVAPKPRPVGSSEKSYVTSTPDGTVTRRLPCWYDRWLAERRLD
ESASDDMEPAELLLSVIFPAYNEEKRIIPTLEEAVAYLDEHVGRNPQPETTAPPEEKRVKALSGPDSGYEILVVD
DGSSDGTVDVVLEFARRHDLHDVLRVVSLARNRGKGGGVTHGLRHVRGAYALFADADGASRFSDVGKLVEGVDRV
ADGSGRGVAIGSRAHLVGSEAVVKRSALRNFLMRSFHLILTILTPPATSRLRDTQCGFKIFTRPSLSHIVPYMHA
EGWIFDIEMLMLAESAPAVPVRAADGSVIGSSPGIKVAEVPVEWHEVGGSKLNVVQDSVKMAVGLAVLRASWMLG
VYRRRLP*
Coding >Ophcf2|02835
ATGGAGTGCCTGCGGCAGCTCGCCGCGCCCAAGAACCTCGCTCTCGGCTGCGTTCTAGGACTCCTCGTTCTCTTT
GGCCTCTTCCTCGTTTTGCACCTCGTGGCGCCGAAACCGCGGCCCGTTGGATCTTCAGAGAAGTCATATGTCACG
TCTACTCCTGATGGAACGGTTACGCGCAGGCTGCCCTGCTGGTACGACCGCTGGCTCGCCGAGCGACGACTGGAT
GAGTCGGCGTCGGACGACATGGAGCCGGCAGAGCTGCTCCTCAGTGTCATATTCCCAGCCTACAACGAGGAGAAG
CGCATAATTCCCACTCTAGAGGAGGCAGTTGCCTACCTAGACGAGCACGTTGGGCGAAACCCACAGCCCGAGACA
ACGGCACCCCCGGAAGAGAAACGAGTCAAGGCCCTCTCAGGTCCCGACAGCGGGTACGAAATCCTCGTGGTCGAC
GACGGCAGCAGCGACGGCACGGTCGATGTGGTGCTCGAGTTTGCGCGCAGACATGACCTTCATGATGTTCTTCGC
GTTGTTTCTCTGGCCAGGAATAGGGGAAAGGGTGGTGGTGTGACGCACGGATTGAGACACGTTCGCGGCGCTTAC
GCTCTCTTCGCCGATGCAGACGGCGCGTCACGCTTCAGTGACGTAGGGAAGCTCGTCGAGGGCGTCGATCGCGTC
GCTGACGGGTCCGGTCGGGGCGTCGCCATCGGAAGTCGAGCGCACCTCGTCGGCAGCGAGGCGGTAGTCAAGCGT
TCCGCTCTCCGCAACTTCCTCATGCGCTCCTTTCACCTTATCCTCACCATCCTCACCCCCCCAGCAACATCCCGC
CTCCGCGACACCCAATGCGGCTTCAAGATCTTCACGCGGCCCTCCCTATCCCACATCGTCCCCTACATGCACGCA
GAGGGTTGGATCTTCGACATCGAGATGCTGATGCTAGCCGAGTCGGCGCCCGCCGTCCCCGTCCGCGCCGCCGAC
GGCTCCGTCATCGGCTCCAGCCCCGGCATTAAGGTCGCCGAGGTCCCCGTCGAGTGGCATGAGGTTGGGGGCAGC
AAGCTCAACGTCGTGCAGGACAGCGTCAAGATGGCGGTTGGCTTGGCGGTTCTGCGGGCGAGCTGGATGCTTGGC
GTTTATCGCAGGAGGCTTCCTTGA
Transcript >Ophcf2|02835
ATGGAGTGCCTGCGGCAGCTCGCCGCGCCCAAGAACCTCGCTCTCGGCTGCGTTCTAGGACTCCTCGTTCTCTTT
GGCCTCTTCCTCGTTTTGCACCTCGTGGCGCCGAAACCGCGGCCCGTTGGATCTTCAGAGAAGTCATATGTCACG
TCTACTCCTGATGGAACGGTTACGCGCAGGCTGCCCTGCTGGTACGACCGCTGGCTCGCCGAGCGACGACTGGAT
GAGTCGGCGTCGGACGACATGGAGCCGGCAGAGCTGCTCCTCAGTGTCATATTCCCAGCCTACAACGAGGAGAAG
CGCATAATTCCCACTCTAGAGGAGGCAGTTGCCTACCTAGACGAGCACGTTGGGCGAAACCCACAGCCCGAGACA
ACGGCACCCCCGGAAGAGAAACGAGTCAAGGCCCTCTCAGGTCCCGACAGCGGGTACGAAATCCTCGTGGTCGAC
GACGGCAGCAGCGACGGCACGGTCGATGTGGTGCTCGAGTTTGCGCGCAGACATGACCTTCATGATGTTCTTCGC
GTTGTTTCTCTGGCCAGGAATAGGGGAAAGGGTGGTGGTGTGACGCACGGATTGAGACACGTTCGCGGCGCTTAC
GCTCTCTTCGCCGATGCAGACGGCGCGTCACGCTTCAGTGACGTAGGGAAGCTCGTCGAGGGCGTCGATCGCGTC
GCTGACGGGTCCGGTCGGGGCGTCGCCATCGGAAGTCGAGCGCACCTCGTCGGCAGCGAGGCGGTAGTCAAGCGT
TCCGCTCTCCGCAACTTCCTCATGCGCTCCTTTCACCTTATCCTCACCATCCTCACCCCCCCAGCAACATCCCGC
CTCCGCGACACCCAATGCGGCTTCAAGATCTTCACGCGGCCCTCCCTATCCCACATCGTCCCCTACATGCACGCA
GAGGGTTGGATCTTCGACATCGAGATGCTGATGCTAGCCGAGTCGGCGCCCGCCGTCCCCGTCCGCGCCGCCGAC
GGCTCCGTCATCGGCTCCAGCCCCGGCATTAAGGTCGCCGAGGTCCCCGTCGAGTGGCATGAGGTTGGGGGCAGC
AAGCTCAACGTCGTGCAGGACAGCGTCAAGATGGCGGTTGGCTTGGCGGTTCTGCGGGCGAGCTGGATGCTTGGC
GTTTATCGCAGGAGGCTTCCTTGA
Gene >Ophcf2|02835
ATGGAGTGCCTGCGGCAGCTCGCCGCGCCCAAGAACCTCGCTCTCGGCTGCGTTCTAGGACTCCTCGTTCTCTTT
GGCGTACGCACCCGTCTCACAAATCGAAGCATTTTCCTGGACTGATGGAGGGACAAACGCAGCTCTTCCTCGTTT
TGCACCTCGTGGCGCCGAAACCGCGGCCCGTTGGATCTTCAGAGAAGTCATATGTCACGTCTACTCCTGATGGAA
CGGTTACGCGCAGGCTGCCCTGCTGGTACGACCGCTGGCTCGCCGAGCGACGACTGGATGAGTCGGCGTCGGACG
ACATGGAGCCGGCAGAGCTGCTCCTCAGTGTCATATTCCCAGCCTACAACGAGGAGAAGCGCATAATTCCCACTC
TAGAGGAGGCAGTTGCCTACCTAGACGAGCACGTTGGGCGAAACCCACAGCCCGAGACAACGGCACCCCCGGAAG
AGAAACGAGTCAAGGCCCTCTCAGGTCCCGACAGCGGGTACGAAATCCTCGTGGTCGACGACGGCAGCAGCGACG
GCACGGTCGATGTGGTGCTCGAGTTTGCGCGCAGACATGACCTTCATGATGTTCTTCGCGTTGTTTCTCTGGCCA
GGAATAGGGGAAAGGGTGGTGGTGTGACGCACGGATTGAGACACGTTCGCGGCGCTTACGCTCTCTTCGCCGATG
CAGACGGCGCGTCACGCTTCAGTGACGTAGGGAAGCTCGTCGAGGGCGTCGATCGCGTCGCTGACGGGTCCGGTC
GGGGCGTCGCCATCGGAAGTCGAGCGCACCTCGTCGGCAGCGAGGCGGTAGTCAAGGTACAGCCCAACAAAAGAC
CACATGCAGATGCCATCTCAGAGACGAAAACTAACGCAGAGAAAACCTCAAGCGTTCCGCTCTCCGCAACTTCCT
CATGCGCTCCTTTCACCTTATCCTCACCATCCTCACCCCCCCAGCAACATCCCGCCTCCGCGACACCCAATGCGG
CTTCAAGATCTTCACGCGGCCCTCCCTATCCCACATCGTCCCCTACATGCACGCAGAGGGTTGGATCTTCGACAT
CGAGATGCTGATGCTAGCCGAGTCGGCGCCCGCCGTCCCCGTCCGCGCCGCCGACGGCTCCGTCATCGGCTCCAG
CCCCGGCATTAAGGTCGCCGAGGTCCCCGTCGAGTGGCATGAGGTTGGGGGCAGCAAGCTCAACGTCGTGCAGGA
CAGCGTCAAGATGGCGGTTGGCTTGGCGGTTCTGCGGGCGAGCTGGATGCTTGGCGTTTATCGCAGGAGGCTTCC
TTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail