Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02834
Gene name
Locationscaffold_02:4894699..4896202
Strand+
Gene length (bp)1503
Transcript length (bp)1503
Coding sequence length (bp)1503
Protein length (aa) 501

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08491 SE Squalene epoxidase 2.7E-82 194 456
PF01266 DAO FAD dependent oxidoreductase 1.4E-07 21 51
PF01494 FAD_binding_3 FAD binding domain 1.7E-06 19 358
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 3.6E-05 24 51

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0004506 squalene monooxygenase activity Yes
GO:0016021 integral component of membrane Yes
GO:0016491 oxidoreductase activity Yes
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0110165 cellular anatomical entity No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0031224 intrinsic component of membrane No
GO:0043167 ion binding No
GO:0003824 catalytic activity No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0000166 nucleotide binding No
GO:0004497 monooxygenase activity No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02834
MSPATVPASARLRREQHHEADVVVVGAGVFGCAMAFALANQGRSVLLLERRMAEPDRIVGELLQPGGMAALRRLG
LGHCVDGIDGIPCHGYHVRYNGLPVDIPYPPIEDDGDVACKWSGASTETEGKRPQGRGFHHGRFITKLRESCQTH
ENITVVETEVTKLVRGQHSPEILGVESLTTTSEKGKRQNDYFFGKLTIIADGYDSKFRRQVVDEKPRVRSKFYAL
ELIDCPLPRDNFGLVVIGEAYPMVLYRIGSRETRILIDVPVGLAAASPAAGGVRGYIRDVAIPALPPACRPSAEL
ALSDGKIPRSMPNSWLPASPQSCQGLVLAGDALNMRHALTGGGMTVALHDALLLAHLLHPDQLRESLDNTRAVSS
AVETFYWRRKNCSSIINVLAQALYALFAAEDRQLRALQRGCFEYFRRGMIDGPCALLGGILHQPSVLAYHFFSVA
FLAIWLHGLAVMGEGVWAPLRAPLVLLDAVLILARASQVFLPLIWREGFR*
Coding >Ophcf2|02834
ATGTCTCCCGCCACCGTCCCCGCCTCGGCCCGGCTCCGGCGCGAGCAGCACCACGAAGCCGACGTCGTAGTCGTC
GGAGCCGGCGTCTTCGGATGCGCAATGGCATTTGCGCTCGCCAATCAGGGTCGTTCCGTCCTTCTTCTCGAACGG
CGGATGGCGGAACCGGATCGGATTGTTGGCGAGTTGCTTCAGCCGGGTGGCATGGCTGCTCTTCGTCGGCTGGGG
CTTGGCCACTGTGTTGATGGCATTGATGGGATTCCCTGTCATGGCTATCATGTTCGTTATAACGGGCTGCCTGTT
GATATTCCGTATCCGCCGATCGAGGATGATGGTGATGTTGCTTGCAAGTGGTCTGGCGCTTCGACGGAGACGGAG
GGGAAGAGACCTCAGGGACGGGGCTTTCACCACGGTCGATTCATCACGAAGCTACGAGAATCATGCCAGACGCAC
GAAAACATCACCGTCGTCGAAACCGAAGTGACCAAGCTCGTCCGCGGCCAACATTCCCCCGAGATCCTCGGCGTC
GAATCCCTCACCACCACCTCGGAAAAAGGCAAACGTCAAAACGACTACTTCTTCGGAAAGCTCACCATCATAGCT
GACGGCTACGACTCCAAGTTCCGACGGCAGGTGGTCGACGAGAAGCCTCGTGTTCGCAGCAAGTTCTACGCCCTT
GAGCTCATCGACTGTCCACTCCCGCGCGATAACTTTGGCCTCGTCGTCATTGGAGAGGCTTACCCCATGGTTCTC
TACCGCATTGGCTCCCGCGAGACGAGGATCCTCATCGACGTCCCTGTTGGACTTGCCGCTGCGTCGCCGGCTGCT
GGTGGTGTTCGCGGTTATATACGGGACGTGGCTATCCCTGCCTTACCGCCCGCGTGTCGACCCTCTGCTGAGCTG
GCGTTATCCGACGGCAAGATACCGCGTAGCATGCCGAATAGCTGGCTTCCTGCTTCGCCGCAGTCTTGTCAGGGG
CTCGTCCTCGCTGGCGATGCCCTTAATATGCGACACGCGCTTACGGGGGGTGGCATGACGGTCGCGCTGCACGAC
GCGCTCCTCCTCGCTCACCTTCTTCACCCAGATCAACTCCGCGAAAGCCTCGACAACACAAGAGCCGTATCCTCC
GCCGTCGAAACCTTCTACTGGCGACGCAAGAACTGCTCCTCCATAATCAACGTCCTCGCCCAAGCCCTCTACGCC
CTCTTCGCCGCCGAAGACCGCCAGCTACGCGCCCTCCAACGCGGCTGCTTCGAGTACTTCCGCCGCGGCATGATC
GACGGCCCCTGCGCCCTCCTCGGCGGAATCCTCCACCAGCCTTCCGTCCTCGCCTACCATTTCTTCTCCGTCGCT
TTCCTCGCCATCTGGCTTCATGGGTTGGCTGTCATGGGGGAGGGGGTTTGGGCCCCGTTGAGGGCGCCGCTTGTG
TTGCTGGATGCTGTGCTCATTCTCGCGAGGGCTAGTCAGGTGTTTTTACCGCTGATTTGGAGGGAGGGGTTTCGT
TGA
Transcript >Ophcf2|02834
ATGTCTCCCGCCACCGTCCCCGCCTCGGCCCGGCTCCGGCGCGAGCAGCACCACGAAGCCGACGTCGTAGTCGTC
GGAGCCGGCGTCTTCGGATGCGCAATGGCATTTGCGCTCGCCAATCAGGGTCGTTCCGTCCTTCTTCTCGAACGG
CGGATGGCGGAACCGGATCGGATTGTTGGCGAGTTGCTTCAGCCGGGTGGCATGGCTGCTCTTCGTCGGCTGGGG
CTTGGCCACTGTGTTGATGGCATTGATGGGATTCCCTGTCATGGCTATCATGTTCGTTATAACGGGCTGCCTGTT
GATATTCCGTATCCGCCGATCGAGGATGATGGTGATGTTGCTTGCAAGTGGTCTGGCGCTTCGACGGAGACGGAG
GGGAAGAGACCTCAGGGACGGGGCTTTCACCACGGTCGATTCATCACGAAGCTACGAGAATCATGCCAGACGCAC
GAAAACATCACCGTCGTCGAAACCGAAGTGACCAAGCTCGTCCGCGGCCAACATTCCCCCGAGATCCTCGGCGTC
GAATCCCTCACCACCACCTCGGAAAAAGGCAAACGTCAAAACGACTACTTCTTCGGAAAGCTCACCATCATAGCT
GACGGCTACGACTCCAAGTTCCGACGGCAGGTGGTCGACGAGAAGCCTCGTGTTCGCAGCAAGTTCTACGCCCTT
GAGCTCATCGACTGTCCACTCCCGCGCGATAACTTTGGCCTCGTCGTCATTGGAGAGGCTTACCCCATGGTTCTC
TACCGCATTGGCTCCCGCGAGACGAGGATCCTCATCGACGTCCCTGTTGGACTTGCCGCTGCGTCGCCGGCTGCT
GGTGGTGTTCGCGGTTATATACGGGACGTGGCTATCCCTGCCTTACCGCCCGCGTGTCGACCCTCTGCTGAGCTG
GCGTTATCCGACGGCAAGATACCGCGTAGCATGCCGAATAGCTGGCTTCCTGCTTCGCCGCAGTCTTGTCAGGGG
CTCGTCCTCGCTGGCGATGCCCTTAATATGCGACACGCGCTTACGGGGGGTGGCATGACGGTCGCGCTGCACGAC
GCGCTCCTCCTCGCTCACCTTCTTCACCCAGATCAACTCCGCGAAAGCCTCGACAACACAAGAGCCGTATCCTCC
GCCGTCGAAACCTTCTACTGGCGACGCAAGAACTGCTCCTCCATAATCAACGTCCTCGCCCAAGCCCTCTACGCC
CTCTTCGCCGCCGAAGACCGCCAGCTACGCGCCCTCCAACGCGGCTGCTTCGAGTACTTCCGCCGCGGCATGATC
GACGGCCCCTGCGCCCTCCTCGGCGGAATCCTCCACCAGCCTTCCGTCCTCGCCTACCATTTCTTCTCCGTCGCT
TTCCTCGCCATCTGGCTTCATGGGTTGGCTGTCATGGGGGAGGGGGTTTGGGCCCCGTTGAGGGCGCCGCTTGTG
TTGCTGGATGCTGTGCTCATTCTCGCGAGGGCTAGTCAGGTGTTTTTACCGCTGATTTGGAGGGAGGGGTTTCGT
TGA
Gene >Ophcf2|02834
ATGTCTCCCGCCACCGTCCCCGCCTCGGCCCGGCTCCGGCGCGAGCAGCACCACGAAGCCGACGTCGTAGTCGTC
GGAGCCGGCGTCTTCGGATGCGCAATGGCATTTGCGCTCGCCAATCAGGGTCGTTCCGTCCTTCTTCTCGAACGG
CGGATGGCGGAACCGGATCGGATTGTTGGCGAGTTGCTTCAGCCGGGTGGCATGGCTGCTCTTCGTCGGCTGGGG
CTTGGCCACTGTGTTGATGGCATTGATGGGATTCCCTGTCATGGCTATCATGTTCGTTATAACGGGCTGCCTGTT
GATATTCCGTATCCGCCGATCGAGGATGATGGTGATGTTGCTTGCAAGTGGTCTGGCGCTTCGACGGAGACGGAG
GGGAAGAGACCTCAGGGACGGGGCTTTCACCACGGTCGATTCATCACGAAGCTACGAGAATCATGCCAGACGCAC
GAAAACATCACCGTCGTCGAAACCGAAGTGACCAAGCTCGTCCGCGGCCAACATTCCCCCGAGATCCTCGGCGTC
GAATCCCTCACCACCACCTCGGAAAAAGGCAAACGTCAAAACGACTACTTCTTCGGAAAGCTCACCATCATAGCT
GACGGCTACGACTCCAAGTTCCGACGGCAGGTGGTCGACGAGAAGCCTCGTGTTCGCAGCAAGTTCTACGCCCTT
GAGCTCATCGACTGTCCACTCCCGCGCGATAACTTTGGCCTCGTCGTCATTGGAGAGGCTTACCCCATGGTTCTC
TACCGCATTGGCTCCCGCGAGACGAGGATCCTCATCGACGTCCCTGTTGGACTTGCCGCTGCGTCGCCGGCTGCT
GGTGGTGTTCGCGGTTATATACGGGACGTGGCTATCCCTGCCTTACCGCCCGCGTGTCGACCCTCTGCTGAGCTG
GCGTTATCCGACGGCAAGATACCGCGTAGCATGCCGAATAGCTGGCTTCCTGCTTCGCCGCAGTCTTGTCAGGGG
CTCGTCCTCGCTGGCGATGCCCTTAATATGCGACACGCGCTTACGGGGGGTGGCATGACGGTCGCGCTGCACGAC
GCGCTCCTCCTCGCTCACCTTCTTCACCCAGATCAACTCCGCGAAAGCCTCGACAACACAAGAGCCGTATCCTCC
GCCGTCGAAACCTTCTACTGGCGACGCAAGAACTGCTCCTCCATAATCAACGTCCTCGCCCAAGCCCTCTACGCC
CTCTTCGCCGCCGAAGACCGCCAGCTACGCGCCCTCCAACGCGGCTGCTTCGAGTACTTCCGCCGCGGCATGATC
GACGGCCCCTGCGCCCTCCTCGGCGGAATCCTCCACCAGCCTTCCGTCCTCGCCTACCATTTCTTCTCCGTCGCT
TTCCTCGCCATCTGGCTTCATGGGTTGGCTGTCATGGGGGAGGGGGTTTGGGCCCCGTTGAGGGCGCCGCTTGTG
TTGCTGGATGCTGTGCTCATTCTCGCGAGGGCTAGTCAGGTGTTTTTACCGCTGATTTGGAGGGAGGGGTTTCGT
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail