Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02834
Gene name
Locationscaffold_02:4894699..4896202
Strand+
Gene length (bp)1503
Transcript length (bp)1503
Coding sequence length (bp)1503
Protein length (aa) 501

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08491 SE Squalene epoxidase 2.7E-82 194 456
PF01266 DAO FAD dependent oxidoreductase 1.4E-07 21 51
PF01494 FAD_binding_3 FAD binding domain 1.7E-06 19 358
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 3.6E-05 24 51

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0004506 squalene monooxygenase activity Yes
GO:0016021 integral component of membrane Yes
GO:0016491 oxidoreductase activity Yes
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0110165 cellular anatomical entity No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0031224 intrinsic component of membrane No
GO:0043167 ion binding No
GO:0003824 catalytic activity No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0000166 nucleotide binding No
GO:0004497 monooxygenase activity No
GO:0036094 small molecule binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Transmembrane domain 0.1743 0.176 0.0314 0.0927 0.2092 0.066 0.6864 0.3871 0.3347 0.0978

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 20 42 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2843
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7727
Ophiocordyceps australis map64 (Brazil) OphauB2|5894
Ophiocordyceps camponoti-floridani Ophcf2|02834 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6539
Ophiocordyceps kimflemingae Ophio5|256
Ophiocordyceps subramaniannii Hirsu2|4651

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02834
MSPATVPASARLRREQHHEADVVVVGAGVFGCAMAFALANQGRSVLLLERRMAEPDRIVGELLQPGGMAALRRLG
LGHCVDGIDGIPCHGYHVRYNGLPVDIPYPPIEDDGDVACKWSGASTETEGKRPQGRGFHHGRFITKLRESCQTH
ENITVVETEVTKLVRGQHSPEILGVESLTTTSEKGKRQNDYFFGKLTIIADGYDSKFRRQVVDEKPRVRSKFYAL
ELIDCPLPRDNFGLVVIGEAYPMVLYRIGSRETRILIDVPVGLAAASPAAGGVRGYIRDVAIPALPPACRPSAEL
ALSDGKIPRSMPNSWLPASPQSCQGLVLAGDALNMRHALTGGGMTVALHDALLLAHLLHPDQLRESLDNTRAVSS
AVETFYWRRKNCSSIINVLAQALYALFAAEDRQLRALQRGCFEYFRRGMIDGPCALLGGILHQPSVLAYHFFSVA
FLAIWLHGLAVMGEGVWAPLRAPLVLLDAVLILARASQVFLPLIWREGFR*
Coding >Ophcf2|02834
ATGTCTCCCGCCACCGTCCCCGCCTCGGCCCGGCTCCGGCGCGAGCAGCACCACGAAGCCGACGTCGTAGTCGTC
GGAGCCGGCGTCTTCGGATGCGCAATGGCATTTGCGCTCGCCAATCAGGGTCGTTCCGTCCTTCTTCTCGAACGG
CGGATGGCGGAACCGGATCGGATTGTTGGCGAGTTGCTTCAGCCGGGTGGCATGGCTGCTCTTCGTCGGCTGGGG
CTTGGCCACTGTGTTGATGGCATTGATGGGATTCCCTGTCATGGCTATCATGTTCGTTATAACGGGCTGCCTGTT
GATATTCCGTATCCGCCGATCGAGGATGATGGTGATGTTGCTTGCAAGTGGTCTGGCGCTTCGACGGAGACGGAG
GGGAAGAGACCTCAGGGACGGGGCTTTCACCACGGTCGATTCATCACGAAGCTACGAGAATCATGCCAGACGCAC
GAAAACATCACCGTCGTCGAAACCGAAGTGACCAAGCTCGTCCGCGGCCAACATTCCCCCGAGATCCTCGGCGTC
GAATCCCTCACCACCACCTCGGAAAAAGGCAAACGTCAAAACGACTACTTCTTCGGAAAGCTCACCATCATAGCT
GACGGCTACGACTCCAAGTTCCGACGGCAGGTGGTCGACGAGAAGCCTCGTGTTCGCAGCAAGTTCTACGCCCTT
GAGCTCATCGACTGTCCACTCCCGCGCGATAACTTTGGCCTCGTCGTCATTGGAGAGGCTTACCCCATGGTTCTC
TACCGCATTGGCTCCCGCGAGACGAGGATCCTCATCGACGTCCCTGTTGGACTTGCCGCTGCGTCGCCGGCTGCT
GGTGGTGTTCGCGGTTATATACGGGACGTGGCTATCCCTGCCTTACCGCCCGCGTGTCGACCCTCTGCTGAGCTG
GCGTTATCCGACGGCAAGATACCGCGTAGCATGCCGAATAGCTGGCTTCCTGCTTCGCCGCAGTCTTGTCAGGGG
CTCGTCCTCGCTGGCGATGCCCTTAATATGCGACACGCGCTTACGGGGGGTGGCATGACGGTCGCGCTGCACGAC
GCGCTCCTCCTCGCTCACCTTCTTCACCCAGATCAACTCCGCGAAAGCCTCGACAACACAAGAGCCGTATCCTCC
GCCGTCGAAACCTTCTACTGGCGACGCAAGAACTGCTCCTCCATAATCAACGTCCTCGCCCAAGCCCTCTACGCC
CTCTTCGCCGCCGAAGACCGCCAGCTACGCGCCCTCCAACGCGGCTGCTTCGAGTACTTCCGCCGCGGCATGATC
GACGGCCCCTGCGCCCTCCTCGGCGGAATCCTCCACCAGCCTTCCGTCCTCGCCTACCATTTCTTCTCCGTCGCT
TTCCTCGCCATCTGGCTTCATGGGTTGGCTGTCATGGGGGAGGGGGTTTGGGCCCCGTTGAGGGCGCCGCTTGTG
TTGCTGGATGCTGTGCTCATTCTCGCGAGGGCTAGTCAGGTGTTTTTACCGCTGATTTGGAGGGAGGGGTTTCGT
TGA
Transcript >Ophcf2|02834
ATGTCTCCCGCCACCGTCCCCGCCTCGGCCCGGCTCCGGCGCGAGCAGCACCACGAAGCCGACGTCGTAGTCGTC
GGAGCCGGCGTCTTCGGATGCGCAATGGCATTTGCGCTCGCCAATCAGGGTCGTTCCGTCCTTCTTCTCGAACGG
CGGATGGCGGAACCGGATCGGATTGTTGGCGAGTTGCTTCAGCCGGGTGGCATGGCTGCTCTTCGTCGGCTGGGG
CTTGGCCACTGTGTTGATGGCATTGATGGGATTCCCTGTCATGGCTATCATGTTCGTTATAACGGGCTGCCTGTT
GATATTCCGTATCCGCCGATCGAGGATGATGGTGATGTTGCTTGCAAGTGGTCTGGCGCTTCGACGGAGACGGAG
GGGAAGAGACCTCAGGGACGGGGCTTTCACCACGGTCGATTCATCACGAAGCTACGAGAATCATGCCAGACGCAC
GAAAACATCACCGTCGTCGAAACCGAAGTGACCAAGCTCGTCCGCGGCCAACATTCCCCCGAGATCCTCGGCGTC
GAATCCCTCACCACCACCTCGGAAAAAGGCAAACGTCAAAACGACTACTTCTTCGGAAAGCTCACCATCATAGCT
GACGGCTACGACTCCAAGTTCCGACGGCAGGTGGTCGACGAGAAGCCTCGTGTTCGCAGCAAGTTCTACGCCCTT
GAGCTCATCGACTGTCCACTCCCGCGCGATAACTTTGGCCTCGTCGTCATTGGAGAGGCTTACCCCATGGTTCTC
TACCGCATTGGCTCCCGCGAGACGAGGATCCTCATCGACGTCCCTGTTGGACTTGCCGCTGCGTCGCCGGCTGCT
GGTGGTGTTCGCGGTTATATACGGGACGTGGCTATCCCTGCCTTACCGCCCGCGTGTCGACCCTCTGCTGAGCTG
GCGTTATCCGACGGCAAGATACCGCGTAGCATGCCGAATAGCTGGCTTCCTGCTTCGCCGCAGTCTTGTCAGGGG
CTCGTCCTCGCTGGCGATGCCCTTAATATGCGACACGCGCTTACGGGGGGTGGCATGACGGTCGCGCTGCACGAC
GCGCTCCTCCTCGCTCACCTTCTTCACCCAGATCAACTCCGCGAAAGCCTCGACAACACAAGAGCCGTATCCTCC
GCCGTCGAAACCTTCTACTGGCGACGCAAGAACTGCTCCTCCATAATCAACGTCCTCGCCCAAGCCCTCTACGCC
CTCTTCGCCGCCGAAGACCGCCAGCTACGCGCCCTCCAACGCGGCTGCTTCGAGTACTTCCGCCGCGGCATGATC
GACGGCCCCTGCGCCCTCCTCGGCGGAATCCTCCACCAGCCTTCCGTCCTCGCCTACCATTTCTTCTCCGTCGCT
TTCCTCGCCATCTGGCTTCATGGGTTGGCTGTCATGGGGGAGGGGGTTTGGGCCCCGTTGAGGGCGCCGCTTGTG
TTGCTGGATGCTGTGCTCATTCTCGCGAGGGCTAGTCAGGTGTTTTTACCGCTGATTTGGAGGGAGGGGTTTCGT
TGA
Gene >Ophcf2|02834
ATGTCTCCCGCCACCGTCCCCGCCTCGGCCCGGCTCCGGCGCGAGCAGCACCACGAAGCCGACGTCGTAGTCGTC
GGAGCCGGCGTCTTCGGATGCGCAATGGCATTTGCGCTCGCCAATCAGGGTCGTTCCGTCCTTCTTCTCGAACGG
CGGATGGCGGAACCGGATCGGATTGTTGGCGAGTTGCTTCAGCCGGGTGGCATGGCTGCTCTTCGTCGGCTGGGG
CTTGGCCACTGTGTTGATGGCATTGATGGGATTCCCTGTCATGGCTATCATGTTCGTTATAACGGGCTGCCTGTT
GATATTCCGTATCCGCCGATCGAGGATGATGGTGATGTTGCTTGCAAGTGGTCTGGCGCTTCGACGGAGACGGAG
GGGAAGAGACCTCAGGGACGGGGCTTTCACCACGGTCGATTCATCACGAAGCTACGAGAATCATGCCAGACGCAC
GAAAACATCACCGTCGTCGAAACCGAAGTGACCAAGCTCGTCCGCGGCCAACATTCCCCCGAGATCCTCGGCGTC
GAATCCCTCACCACCACCTCGGAAAAAGGCAAACGTCAAAACGACTACTTCTTCGGAAAGCTCACCATCATAGCT
GACGGCTACGACTCCAAGTTCCGACGGCAGGTGGTCGACGAGAAGCCTCGTGTTCGCAGCAAGTTCTACGCCCTT
GAGCTCATCGACTGTCCACTCCCGCGCGATAACTTTGGCCTCGTCGTCATTGGAGAGGCTTACCCCATGGTTCTC
TACCGCATTGGCTCCCGCGAGACGAGGATCCTCATCGACGTCCCTGTTGGACTTGCCGCTGCGTCGCCGGCTGCT
GGTGGTGTTCGCGGTTATATACGGGACGTGGCTATCCCTGCCTTACCGCCCGCGTGTCGACCCTCTGCTGAGCTG
GCGTTATCCGACGGCAAGATACCGCGTAGCATGCCGAATAGCTGGCTTCCTGCTTCGCCGCAGTCTTGTCAGGGG
CTCGTCCTCGCTGGCGATGCCCTTAATATGCGACACGCGCTTACGGGGGGTGGCATGACGGTCGCGCTGCACGAC
GCGCTCCTCCTCGCTCACCTTCTTCACCCAGATCAACTCCGCGAAAGCCTCGACAACACAAGAGCCGTATCCTCC
GCCGTCGAAACCTTCTACTGGCGACGCAAGAACTGCTCCTCCATAATCAACGTCCTCGCCCAAGCCCTCTACGCC
CTCTTCGCCGCCGAAGACCGCCAGCTACGCGCCCTCCAACGCGGCTGCTTCGAGTACTTCCGCCGCGGCATGATC
GACGGCCCCTGCGCCCTCCTCGGCGGAATCCTCCACCAGCCTTCCGTCCTCGCCTACCATTTCTTCTCCGTCGCT
TTCCTCGCCATCTGGCTTCATGGGTTGGCTGTCATGGGGGAGGGGGTTTGGGCCCCGTTGAGGGCGCCGCTTGTG
TTGCTGGATGCTGTGCTCATTCTCGCGAGGGCTAGTCAGGTGTTTTTACCGCTGATTTGGAGGGAGGGGTTTCGT
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail