Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02824
Gene name
Locationscaffold_02:4875770..4878213
Strand+
Gene length (bp)2443
Transcript length (bp)2229
Coding sequence length (bp)2229
Protein length (aa) 743

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13854 Kelch_5 Kelch motif 7.6E-11 324 372

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 517 539 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 28.98 16.22 41.73
Alive In ants, during behavior modification 27.45 15.20 39.69
Dead In ants, recently dead 29.93 16.80 43.05

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.823506 no
Alive Dead 0.660615 no
Dead Fungus 0.897004 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02824
MRPHGGLFVVAAALQGRTAAQLGGWQDNQINTTICYWKQPRAALIRDTVYLDGGELWWSPGLASGSLGPPTNQGN
FQGTILTFNLSTPMTETTNTTALLLNHPLQKAHGVSASPNALDGGMLANDAEFFLYGGALLRNDVLYQQPASDAV
LAYQAFKYGVEKPLMPEGFRDARLDQGVTRYLAYGAAASAPSENKAWYFSGLSSPSRGPILSNPSLNGSTRAMNV
SNTLVTLDMSVQLGEKWSNDTLPSTVKGRSNAEVVWVPVGKQGILVVLGGVTYPEWASDIHKSDDEAASTRESPA
FMRNIDIYDVATGRWYQQPTTGGPASRARGCAVVAPAADRSSFNIYYYGGFDGIHPQSPFHDDVWVLSLPSFTWT
LINRGTELHARAGHRCFLPYPDQMMVFGGYAAEAGDLPSCLDGGPIVVFNITSGEWIKSYDPATYGPYGVHENVR
AVIGGDASGGATATAPAPSAWAAPELGRVFADRYDSSKIKTYWPYQTSVTSGRAEIPAGQASNSKRVIIPAVVVP
IVVLAGMAVVVWGYRLRRHRSRVSSSQDSDEAAMRIRSWVRGQATGKSLTMTSSGAVSPEPEMMSASPMSPVSLS
THHEMADTQVAELADTSPPVELHDTGLTPLEVIQKHTGFRPNRLQSPSDPSHSSLSCPGDNNSFVSQSSGAAHVD
SPLLGCSPLLDLKPTTDPRRSGALPSMTEEPPQGSASRYDEGQSSTVPVKKSVFRENVGDDGRDVEV*
Coding >Ophcf2|02824
ATGCGGCCTCACGGTGGCCTATTCGTGGTAGCGGCCGCCCTGCAAGGTCGGACAGCCGCTCAGTTGGGCGGATGG
CAGGACAATCAGATCAACACCACCATCTGCTACTGGAAACAGCCCCGAGCCGCATTGATCCGCGACACCGTCTAT
CTCGACGGCGGTGAACTCTGGTGGTCCCCAGGTCTAGCCAGCGGCTCTCTCGGCCCCCCCACGAACCAAGGCAAC
TTCCAAGGCACAATCCTGACCTTCAACCTCAGCACCCCCATGACGGAAACAACAAACACAACAGCCCTGCTACTA
AACCACCCCCTCCAGAAAGCCCACGGCGTCAGCGCCTCCCCCAACGCCCTGGATGGAGGCATGCTCGCCAACGAC
GCCGAGTTCTTCCTTTATGGAGGCGCGCTTCTTCGCAATGACGTACTGTATCAGCAGCCCGCTTCTGATGCCGTG
CTCGCCTATCAGGCTTTCAAGTATGGCGTTGAGAAGCCGCTCATGCCCGAGGGCTTTCGCGATGCGAGACTTGAT
CAGGGTGTCACTCGTTATCTTGCCTACGGGGCTGCTGCCAGCGCGCCGTCTGAGAATAAGGCCTGGTACTTTTCC
GGCCTTTCGTCACCGTCGAGGGGCCCTATTCTCTCGAATCCGAGTCTTAACGGGTCGACGCGGGCCATGAATGTG
TCCAATACGCTCGTCACGCTCGACATGTCGGTCCAGCTGGGCGAGAAGTGGTCCAACGACACCCTCCCATCCACC
GTCAAGGGACGTTCCAATGCTGAAGTCGTCTGGGTCCCCGTCGGGAAGCAGGGCATTCTCGTCGTTCTCGGAGGC
GTAACTTATCCCGAATGGGCTTCCGATATTCACAAGTCTGACGACGAAGCCGCGAGCACACGAGAGAGTCCGGCC
TTTATGCGTAACATCGACATCTATGACGTCGCCACTGGCCGCTGGTATCAGCAACCGACCACAGGCGGTCCCGCC
TCTCGAGCCAGGGGCTGCGCCGTCGTAGCTCCAGCCGCCGATCGTTCCAGCTTCAATATCTACTACTATGGCGGC
TTCGATGGCATCCATCCGCAGAGCCCCTTTCACGACGACGTCTGGGTCCTCTCCCTGCCGTCCTTTACCTGGACC
CTCATCAACAGGGGCACCGAGCTTCACGCCCGCGCCGGCCATCGCTGCTTCTTGCCCTATCCCGATCAGATGATG
GTATTTGGCGGATACGCTGCCGAGGCCGGTGACCTTCCCTCTTGTCTCGATGGCGGGCCCATCGTCGTCTTTAAC
ATCACCAGCGGAGAATGGATCAAGTCGTATGACCCGGCCACGTACGGCCCGTACGGCGTCCACGAAAACGTCCGG
GCCGTCATCGGAGGAGACGCGTCGGGAGGCGCTACGGCAACGGCGCCGGCACCTTCGGCATGGGCCGCGCCCGAA
CTGGGCCGCGTCTTCGCAGATCGATACGATAGCAGCAAGATCAAGACGTACTGGCCCTACCAGACGTCCGTCACC
TCCGGCCGCGCCGAGATTCCCGCCGGCCAGGCGAGTAACAGCAAGCGCGTCATCATCCCCGCCGTCGTCGTGCCC
ATAGTGGTCCTCGCCGGCATGGCCGTCGTCGTCTGGGGGTACCGTCTCAGGCGCCACCGTTCCCGCGTCAGCTCC
TCCCAAGACTCGGACGAGGCAGCCATGCGGATCCGATCTTGGGTCAGGGGCCAGGCGACCGGCAAGTCGCTGACC
ATGACGAGCTCGGGAGCGGTATCGCCGGAGCCGGAGATGATGTCGGCCAGCCCCATGTCTCCCGTCTCACTGTCG
ACTCATCATGAAATGGCCGATACGCAGGTGGCCGAGCTGGCAGACACGTCGCCGCCCGTCGAGCTGCACGACACG
GGCCTTACCCCCCTGGAGGTGATACAGAAGCATACGGGCTTCAGGCCAAACAGGCTGCAGTCGCCCTCGGATCCC
TCCCACAGCTCCCTCTCGTGCCCGGGAGACAACAACAGCTTTGTGTCGCAGTCATCGGGAGCGGCTCATGTGGAC
TCTCCCCTGCTGGGTTGCAGCCCGCTGCTCGACCTCAAACCCACAACCGACCCGAGGCGGTCAGGCGCGCTGCCG
TCCATGACGGAAGAGCCGCCGCAGGGCTCCGCGTCACGGTATGACGAGGGGCAGTCATCGACTGTGCCGGTCAAG
AAGAGCGTCTTTCGAGAGAACGTGGGCGACGACGGAAGGGACGTCGAGGTGTAA
Transcript >Ophcf2|02824
ATGCGGCCTCACGGTGGCCTATTCGTGGTAGCGGCCGCCCTGCAAGGTCGGACAGCCGCTCAGTTGGGCGGATGG
CAGGACAATCAGATCAACACCACCATCTGCTACTGGAAACAGCCCCGAGCCGCATTGATCCGCGACACCGTCTAT
CTCGACGGCGGTGAACTCTGGTGGTCCCCAGGTCTAGCCAGCGGCTCTCTCGGCCCCCCCACGAACCAAGGCAAC
TTCCAAGGCACAATCCTGACCTTCAACCTCAGCACCCCCATGACGGAAACAACAAACACAACAGCCCTGCTACTA
AACCACCCCCTCCAGAAAGCCCACGGCGTCAGCGCCTCCCCCAACGCCCTGGATGGAGGCATGCTCGCCAACGAC
GCCGAGTTCTTCCTTTATGGAGGCGCGCTTCTTCGCAATGACGTACTGTATCAGCAGCCCGCTTCTGATGCCGTG
CTCGCCTATCAGGCTTTCAAGTATGGCGTTGAGAAGCCGCTCATGCCCGAGGGCTTTCGCGATGCGAGACTTGAT
CAGGGTGTCACTCGTTATCTTGCCTACGGGGCTGCTGCCAGCGCGCCGTCTGAGAATAAGGCCTGGTACTTTTCC
GGCCTTTCGTCACCGTCGAGGGGCCCTATTCTCTCGAATCCGAGTCTTAACGGGTCGACGCGGGCCATGAATGTG
TCCAATACGCTCGTCACGCTCGACATGTCGGTCCAGCTGGGCGAGAAGTGGTCCAACGACACCCTCCCATCCACC
GTCAAGGGACGTTCCAATGCTGAAGTCGTCTGGGTCCCCGTCGGGAAGCAGGGCATTCTCGTCGTTCTCGGAGGC
GTAACTTATCCCGAATGGGCTTCCGATATTCACAAGTCTGACGACGAAGCCGCGAGCACACGAGAGAGTCCGGCC
TTTATGCGTAACATCGACATCTATGACGTCGCCACTGGCCGCTGGTATCAGCAACCGACCACAGGCGGTCCCGCC
TCTCGAGCCAGGGGCTGCGCCGTCGTAGCTCCAGCCGCCGATCGTTCCAGCTTCAATATCTACTACTATGGCGGC
TTCGATGGCATCCATCCGCAGAGCCCCTTTCACGACGACGTCTGGGTCCTCTCCCTGCCGTCCTTTACCTGGACC
CTCATCAACAGGGGCACCGAGCTTCACGCCCGCGCCGGCCATCGCTGCTTCTTGCCCTATCCCGATCAGATGATG
GTATTTGGCGGATACGCTGCCGAGGCCGGTGACCTTCCCTCTTGTCTCGATGGCGGGCCCATCGTCGTCTTTAAC
ATCACCAGCGGAGAATGGATCAAGTCGTATGACCCGGCCACGTACGGCCCGTACGGCGTCCACGAAAACGTCCGG
GCCGTCATCGGAGGAGACGCGTCGGGAGGCGCTACGGCAACGGCGCCGGCACCTTCGGCATGGGCCGCGCCCGAA
CTGGGCCGCGTCTTCGCAGATCGATACGATAGCAGCAAGATCAAGACGTACTGGCCCTACCAGACGTCCGTCACC
TCCGGCCGCGCCGAGATTCCCGCCGGCCAGGCGAGTAACAGCAAGCGCGTCATCATCCCCGCCGTCGTCGTGCCC
ATAGTGGTCCTCGCCGGCATGGCCGTCGTCGTCTGGGGGTACCGTCTCAGGCGCCACCGTTCCCGCGTCAGCTCC
TCCCAAGACTCGGACGAGGCAGCCATGCGGATCCGATCTTGGGTCAGGGGCCAGGCGACCGGCAAGTCGCTGACC
ATGACGAGCTCGGGAGCGGTATCGCCGGAGCCGGAGATGATGTCGGCCAGCCCCATGTCTCCCGTCTCACTGTCG
ACTCATCATGAAATGGCCGATACGCAGGTGGCCGAGCTGGCAGACACGTCGCCGCCCGTCGAGCTGCACGACACG
GGCCTTACCCCCCTGGAGGTGATACAGAAGCATACGGGCTTCAGGCCAAACAGGCTGCAGTCGCCCTCGGATCCC
TCCCACAGCTCCCTCTCGTGCCCGGGAGACAACAACAGCTTTGTGTCGCAGTCATCGGGAGCGGCTCATGTGGAC
TCTCCCCTGCTGGGTTGCAGCCCGCTGCTCGACCTCAAACCCACAACCGACCCGAGGCGGTCAGGCGCGCTGCCG
TCCATGACGGAAGAGCCGCCGCAGGGCTCCGCGTCACGGTATGACGAGGGGCAGTCATCGACTGTGCCGGTCAAG
AAGAGCGTCTTTCGAGAGAACGTGGGCGACGACGGAAGGGACGTCGAGGTGTAA
Gene >Ophcf2|02824
ATGCGGCCTCACGGTGGCCTATTCGTGGTAGCGGCCGCCCTGCAAGGTCGGACAGCCGCTCAGTTGGGCGGATGG
CAGGACAATCAGATCAACACCACCATCTGCTACTGGAAACAGCCCCGAGGTACGAAGCCCCCCCCCCCAGCAGAA
TCCCGACGACGAAGCTAAAGATTACCAGCCGCATTGATCCGCGACACCGTCTATCTCGACGGCGGTGAACTCTGG
TGGTCCCCAGGTCTAGCCAGCGGCTCTCTCGGCCCCCCCACGAACCAAGGTCCGCCCTCCTAAACCCCTAAACGA
ACCCAATCTGACAACCCTCAGGCAACTTCCAAGGCACAATCCTGACCTTCAACCTCAGCACCCCCATGACGGAAA
CAACAAACACAACAGCCCTGCTACTAAACCACCCCCTCCAGAAAGCCCACGGCGTCAGCGCCTCCCCCAACGCCC
TGGATGGAGGCATGCTCGCCAACGACGCCGAGTTCTTCCTTTATGGAGGCGCGCTTCTTCGCAATGACGTACTGT
ATCAGCAGCCCGCTTCTGATGCCGTGCTCGCCTATCAGGCTTTCAAGTATGGCGTTGAGAAGCCGCTCATGCCCG
AGGGCTTTCGCGATGCGAGACTTGATCAGGGTGTCACTCGTTATCTTGCCTACGGGGCTGCTGCCAGCGCGCCGT
CTGAGAATAAGGCCTGGTACTTTTCCGGCCTTTCGTCACCGTCGAGGGGCCCTATTCTCTCGAATCCGAGTCTTA
ACGGGTCGACGCGGGCCATGAATGTGTCCAATACGCTCGTCACGCTCGACATGTCGGTCCAGCTGGGCGAGAAGT
GGTCCAACGACACCCTCCCATCCACCGTCAAGGGACGTTCCAATGCTGAAGTCGTCTGGGTCCCCGTCGGGAAGC
AGGGCATTCTCGTCGTTCTCGGAGGCGTAACTTATCCCGAATGGGCTTCCGATATTCACAAGTCTGACGACGAAG
CCGCGAGCGTGAGTGGTGAATACAACCTCCGCCGTTGATGGACGCTGACGATACACCGTCAAGACACGAGAGAGT
CCGGCCTTTATGCGTAACATCGACATCTATGACGTCGCCACTGGCCGCTGGTATCAGCAACCGACCACAGGCGGT
CCCGCCTCTCGAGCCAGGGGCTGCGCCGTCGTAGCTCCAGCCGCCGATCGTTCCAGCTTCAATATCTACTACTAT
GGCGGCTTCGATGGCATCCATCCGCAGAGCCCCTTTCACGACGACGTCTGGGTCCTCTCCCTGCCGTCCTTTACC
TGGACCCTCATCAACAGGGGCACCGAGCTTCACGCCCGCGCCGGCCATCGCTGCTTCTTGCCCTATCCCGATCAG
ATGATGGTATTTGGCGGATACGCTGCCGAGGCCGGTGACCTTCCCTCTTGTCTCGATGGCGGGCCCATCGTCGTC
TTTAACATCACCAGCGGAGAATGGATCAAGTCGTATGACCCGGCCACGTACGGCCCGTACGGCGTCCACGAAAAC
GTCCGGGCCGTCATCGGAGGAGACGCGTCGGGAGGCGCTACGGCAACGGCGCCGGCACCTTCGGCATGGGCCGCG
CCCGAACTGGGCCGCGTCTTCGCAGATCGATACGATAGCAGCAAGATCAAGACGTACTGGCCCTACCAGACGTCC
GTCACCTCCGGCCGCGCCGAGATTCCCGCCGGCCAGGCGAGTAACAGCAAGCGCGTCATCATCCCCGCCGTCGTC
GTGCCCATAGTGGTCCTCGCCGGCATGGCCGTCGTCGTCTGGGGGTACCGTCTCAGGCGCCACCGTTCCCGCGTC
AGCTCCTCCCAAGACTCGGACGAGGCAGCCATGCGGATCCGATCTTGGGTCAGGGGCCAGGCGACCGGCAAGTCG
CTGACCATGACGAGCTCGGGAGCGGTATCGCCGGAGCCGGAGATGATGTCGGCCAGCCCCATGTCTCCCGTCTCA
CTGTCGACTCATCATGAAATGGCCGATACGCAGGTGGCCGAGCTGGCAGGTGAGTTTGCCGCGGATACGTGCCAG
GGAGCACGGTCGCTGACAGAGCCCCGTGACAGACACGTCGCCGCCCGTCGAGCTGCACGACACGGGCCTTACCCC
CCTGGAGGTGATACAGAAGCATACGGGCTTCAGGCCAAACAGGCTGCAGTCGCCCTCGGATCCCTCCCACAGCTC
CCTCTCGTGCCCGGGAGACAACAACAGCTTTGTGTCGCAGTCATCGGGAGCGGCTCATGTGGACTCTCCCCTGCT
GGGTTGCAGCCCGCTGCTCGACCTCAAACCCACAACCGACCCGAGGCGGTCAGGCGCGCTGCCGTCCATGACGGA
AGAGCCGCCGCAGGGCTCCGCGTCACGGTATGACGAGGGGCAGTCATCGACTGTGCCGGTCAAGAAGAGCGTCTT
TCGAGAGAACGTGGGCGACGACGGAAGGGACGTCGAGGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail