Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02819
Gene name
Locationscaffold_02:4865248..4866069
Strand-
Gene length (bp)821
Transcript length (bp)420
Coding sequence length (bp)420
Protein length (aa) 140

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13499 EF-hand_7 EF-hand domain pair 6.5E-08 77 133
PF13833 EF-hand_8 EF-hand domain pair 2.5E-05 89 132

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6641 0.7247 0.1049 0.1105 0.0779 0.1077 0.1718 0.0479 0.0706 0.0003

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6158
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4614
Ophiocordyceps australis map64 (Brazil) OphauB2|2203
Ophiocordyceps camponoti-floridani Ophcf2|02819 (this protein)
Ophiocordyceps kimflemingae Ophio5|6966
Ophiocordyceps subramaniannii Hirsu2|4969

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02819
MASTNYKEAFALFDKRGNGRVAADSLGDLLRACGQNPTLAEIHELEKTAGADFDFESFQRILNRPGGFRDPGEPE
EYCRGFQVFDKDMTGFIGVGQLKYILTNLGEKMTEDEVDELLKAVDTSSGQVNYTDLVRTILAN*
Coding >Ophcf2|02819
ATGGCTTCGACCAACTACAAGGAGGCCTTTGCCCTGTTCGACAAGCGCGGCAATGGACGCGTCGCGGCTGATTCC
CTCGGCGACCTCCTACGCGCGTGCGGACAGAACCCGACGCTGGCCGAGATCCACGAGCTGGAGAAGACGGCCGGC
GCAGACTTCGACTTTGAGTCCTTCCAGCGTATCCTCAACCGTCCCGGTGGCTTTCGCGATCCTGGCGAGCCGGAA
GAGTATTGTCGTGGCTTCCAGGTCTTTGACAAGGATATGACGGGCTTCATTGGCGTCGGCCAGCTCAAGTACATT
CTCACCAACCTGGGCGAAAAGATGACCGAAGACGAGGTCGACGAGCTGCTCAAGGCCGTCGACACCAGCTCTGGC
CAGGTCAACTATACGGATCTTGTCCGGACCATCCTCGCCAACTGA
Transcript >Ophcf2|02819
ATGGCTTCGACCAACTACAAGGAGGCCTTTGCCCTGTTCGACAAGCGCGGCAATGGACGCGTCGCGGCTGATTCC
CTCGGCGACCTCCTACGCGCGTGCGGACAGAACCCGACGCTGGCCGAGATCCACGAGCTGGAGAAGACGGCCGGC
GCAGACTTCGACTTTGAGTCCTTCCAGCGTATCCTCAACCGTCCCGGTGGCTTTCGCGATCCTGGCGAGCCGGAA
GAGTATTGTCGTGGCTTCCAGGTCTTTGACAAGGATATGACGGGCTTCATTGGCGTCGGCCAGCTCAAGTACATT
CTCACCAACCTGGGCGAAAAGATGACCGAAGACGAGGTCGACGAGCTGCTCAAGGCCGTCGACACCAGCTCTGGC
CAGGTCAACTATACGGATCTTGTCCGGACCATCCTCGCCAACTGA
Gene >Ophcf2|02819
ATGGTGAGTCGCCACGTAAACAATGCAGCCCCGCCGCGTTCCTTGATTCGCCGGGGAGAGATACCCCCCCAAAAA
AATTAAAAAAAAAAAAAGAAGAGGAAGAGGAAGAAGAGGAAGAAGAAGGATTCCCCCTCGGACTCGGCTGCAAAG
AAATCACTGGACAAACTCTGTCATCATCTTCGCATCGTCATGGCTTCTAACCACTTTGATTCCCAGGCTTCGACC
AACTACAAGGAGGCCTTTGCCCTGTTCGACAAGCGCGGCAATGGACGCGTCGCGGCTGATTCCCTCGGCGACCTC
CTACGCGCGTGCGGACAGAACCCGACGCTGGCCGAGATCCACGAGCTGGAGAAGACGGCCGGCGCAGACTGTGAG
TGGGACCGAGCTTGCTTTCTACCTACCTAGTCAGGGGCTTCCCGTGGATGGGATTACGCTATGGGATGCGCTGGG
AAAAGAAAAAAGAAACTACCTTGTAACGGTTGCTGACGGTCTTTCAGTCGACTTTGAGTCCTTCCAGCGTATCCT
CAACCGTCCCGGTGGCTTTCGCGATCCTGGCGAGCCGGAAGAGTATTGTCGTGGCTTCCAGGTCTTTGACAAGGA
TATGACGGGCTTCATTGGCGTCGGCCAGCTCAAGTACATTCTCACCAACCTGGGCGAAAAGATGACCGAAGACGA
GGTCGACGAGCTGCTCAAGGCCGTCGACACCAGCTCTGGCCAGGTCAACTATACGGGTGAGTTCTCCTCCGACTC
TACTGCCTTTGCCTTGTTCTCTGCGGCTGACGTCCCGGCCAGATCTTGTCCGGACCATCCTCGCCAACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail