Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02810
Gene name
Locationscaffold_02:4833866..4836011
Strand+
Gene length (bp)2145
Transcript length (bp)2022
Coding sequence length (bp)2022
Protein length (aa) 674

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00615 RGS Regulator of G protein signaling domain 2.1E-36 505 649
PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP) 7.8E-19 385 466

GO

GO Term Description Terminal node
GO:0035556 intracellular signal transduction Yes
GO:0007165 signal transduction No
GO:0008150 biological_process No
GO:0050789 regulation of biological process No
GO:0009987 cellular process No
GO:0065007 biological regulation No
GO:0050794 regulation of cellular process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.5774 0.3183 0.0313 0.2342 0.1983 0.0413 0.2175 0.3141 0.2859 0.0435

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1983
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|708
Ophiocordyceps australis map64 (Brazil) OphauB2|5202
Ophiocordyceps camponoti-floridani Ophcf2|02810 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|138
Ophiocordyceps kimflemingae Ophio5|8508
Ophiocordyceps subramaniannii Hirsu2|2183

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02810
MAAISNPLSTVASKPSLSARSELPKRKLSLSTPRSSVSERSSDPTTAAARHSSNPSVGSASNRSQRSLLNRAVAA
LDRTQSAFASFSDPVIRPRQSVSGLSRLTPPSSEPSSPAKKTEFKVSTSPTSARGPRLDDCLPAPEESPVGPCPD
TLLHRAPTPVKSQPLVDSKMHQTSSRLLRMTDDDRPFTRDFKDLFATLVVSLLPLSAHRVRLSKVEYTFLSEDAI
NNLGSLKFSQSNRMPDPKDPSRIVTTTTTTTFSMAKDMARSICQRFLEARFIESADGKYQQVYNMKGSVWQLTPK
GITVLDRFCSRNGIQQKQVGELSSINSAQLVILERDQISDKLLNDLGTIEVIFRRFVGSDGRNLKASPTAADSDS
LHDYRDGLTGVKMAAERKINGRIYRDTFTGKATTDWLMDCSTIVDRRETVEIATLFVEYGLIEALVQDKVFIQQN
TGYNLFQPTKHSIYQLTQRGKDLISGNGSRGRASGSEGGAGSQRNGICRDSNTQRLDKILTDPALRLLFRENLRE
THCEENLSFYQDVTEFVRSCKAAIRQAQKSPTATSMDSIKEIMAQAYGIYNAFLAPGSPCELNIDHQLRNNLATR
MTKAVGQDNSMIDTLQEVTTLFEDAQNAVFKLMASDSVPKFLRNAKYEQQLRIHDLDVNGRMPERSQSRSTRQ*
Coding >Ophcf2|02810
ATGGCAGCCATCTCGAATCCCCTCTCGACCGTCGCCTCGAAACCCTCTCTGTCAGCCAGGTCAGAGCTCCCGAAG
CGAAAACTCAGTCTGTCTACACCTCGCTCCTCCGTCTCGGAACGGTCCTCCGACCCGACGACAGCCGCCGCTCGT
CACTCGAGCAACCCGTCGGTCGGGTCCGCCTCGAACCGTTCCCAACGCAGCCTCCTGAATCGTGCCGTGGCCGCC
CTCGATCGCACCCAGAGCGCCTTCGCCAGCTTTTCCGACCCCGTCATCCGCCCCCGCCAGTCCGTTTCGGGCCTG
TCCCGACTCACGCCGCCCTCCTCCGAGCCTTCCAGCCCGGCCAAGAAGACCGAGTTCAAGGTGTCGACTAGCCCG
ACGTCGGCCCGAGGTCCCAGGCTCGACGACTGCCTGCCTGCCCCCGAAGAGTCGCCCGTCGGGCCCTGTCCGGAC
ACGCTCCTCCACCGTGCACCCACCCCGGTCAAGTCACAGCCTCTGGTCGACAGCAAGATGCACCAGACGTCTTCG
CGCTTGCTGCGCATGACCGACGATGATCGGCCTTTTACTAGGGACTTTAAGGATCTCTTTGCCACTCTCGTCGTC
AGCTTGCTCCCCCTCTCGGCACATCGCGTCCGCCTCTCCAAGGTCGAGTACACTTTTCTGTCTGAAGATGCCATC
AACAATCTCGGCTCCCTCAAGTTCTCTCAATCGAACCGCATGCCGGACCCCAAAGACCCCTCTCGCATCGTCACC
ACCACGACGACCACTACCTTTTCCATGGCCAAGGACATGGCACGCTCCATCTGCCAGCGCTTCCTCGAGGCCCGC
TTCATCGAGTCGGCCGACGGCAAGTACCAGCAGGTCTACAACATGAAGGGCTCCGTCTGGCAGCTCACGCCCAAG
GGCATCACCGTCCTCGACCGCTTCTGCTCCCGCAATGGCATCCAGCAGAAGCAGGTGGGCGAGCTCTCTAGCATA
AATTCGGCTCAGCTCGTCATCCTCGAGCGCGACCAGATATCGGACAAGCTCCTCAACGACCTCGGAACTATCGAA
GTCATTTTCCGCAGGTTCGTCGGCTCCGACGGCCGCAACCTCAAGGCCTCGCCCACGGCCGCCGACTCGGACTCG
CTCCACGACTACCGCGACGGCCTCACCGGCGTCAAGATGGCCGCCGAGCGCAAGATCAACGGCCGCATATACCGC
GACACCTTTACCGGCAAGGCCACCACCGATTGGCTCATGGACTGCTCCACCATTGTCGACCGCCGCGAGACGGTC
GAGATTGCCACCCTCTTCGTCGAGTACGGCCTCATCGAGGCCCTGGTTCAGGACAAGGTCTTCATTCAGCAGAAC
ACGGGCTACAACTTGTTCCAGCCCACGAAGCACTCCATCTACCAGCTGACGCAGCGCGGCAAGGACCTCATCAGC
GGAAACGGCTCCAGGGGCCGTGCCTCGGGCAGTGAGGGCGGCGCCGGATCTCAGCGCAACGGCATCTGCCGCGAC
TCCAACACGCAGCGGCTGGACAAGATTCTCACCGACCCGGCTCTCCGCCTGCTGTTCCGCGAGAACCTGCGCGAG
ACGCACTGCGAGGAGAACCTGTCGTTTTACCAGGACGTGACCGAATTCGTCCGCAGCTGCAAGGCGGCCATCCGA
CAGGCGCAAAAGTCGCCGACTGCCACGTCGATGGACTCGATCAAGGAGATCATGGCCCAGGCGTACGGCATCTAC
AACGCCTTCCTCGCGCCCGGCTCCCCTTGCGAGCTCAACATCGACCACCAGCTGCGAAACAACCTGGCGACGCGC
ATGACAAAGGCCGTCGGACAGGACAATTCGATGATCGACACGCTGCAGGAGGTGACGACGCTGTTCGAGGACGCT
CAGAATGCCGTGTTCAAGCTCATGGCCAGCGACTCGGTGCCCAAGTTCCTCCGCAACGCGAAATACGAGCAGCAG
CTCCGGATCCACGACCTCGACGTCAACGGCCGAATGCCCGAACGAAGTCAGAGCCGTTCCACGCGCCAGTGA
Transcript >Ophcf2|02810
ATGGCAGCCATCTCGAATCCCCTCTCGACCGTCGCCTCGAAACCCTCTCTGTCAGCCAGGTCAGAGCTCCCGAAG
CGAAAACTCAGTCTGTCTACACCTCGCTCCTCCGTCTCGGAACGGTCCTCCGACCCGACGACAGCCGCCGCTCGT
CACTCGAGCAACCCGTCGGTCGGGTCCGCCTCGAACCGTTCCCAACGCAGCCTCCTGAATCGTGCCGTGGCCGCC
CTCGATCGCACCCAGAGCGCCTTCGCCAGCTTTTCCGACCCCGTCATCCGCCCCCGCCAGTCCGTTTCGGGCCTG
TCCCGACTCACGCCGCCCTCCTCCGAGCCTTCCAGCCCGGCCAAGAAGACCGAGTTCAAGGTGTCGACTAGCCCG
ACGTCGGCCCGAGGTCCCAGGCTCGACGACTGCCTGCCTGCCCCCGAAGAGTCGCCCGTCGGGCCCTGTCCGGAC
ACGCTCCTCCACCGTGCACCCACCCCGGTCAAGTCACAGCCTCTGGTCGACAGCAAGATGCACCAGACGTCTTCG
CGCTTGCTGCGCATGACCGACGATGATCGGCCTTTTACTAGGGACTTTAAGGATCTCTTTGCCACTCTCGTCGTC
AGCTTGCTCCCCCTCTCGGCACATCGCGTCCGCCTCTCCAAGGTCGAGTACACTTTTCTGTCTGAAGATGCCATC
AACAATCTCGGCTCCCTCAAGTTCTCTCAATCGAACCGCATGCCGGACCCCAAAGACCCCTCTCGCATCGTCACC
ACCACGACGACCACTACCTTTTCCATGGCCAAGGACATGGCACGCTCCATCTGCCAGCGCTTCCTCGAGGCCCGC
TTCATCGAGTCGGCCGACGGCAAGTACCAGCAGGTCTACAACATGAAGGGCTCCGTCTGGCAGCTCACGCCCAAG
GGCATCACCGTCCTCGACCGCTTCTGCTCCCGCAATGGCATCCAGCAGAAGCAGGTGGGCGAGCTCTCTAGCATA
AATTCGGCTCAGCTCGTCATCCTCGAGCGCGACCAGATATCGGACAAGCTCCTCAACGACCTCGGAACTATCGAA
GTCATTTTCCGCAGGTTCGTCGGCTCCGACGGCCGCAACCTCAAGGCCTCGCCCACGGCCGCCGACTCGGACTCG
CTCCACGACTACCGCGACGGCCTCACCGGCGTCAAGATGGCCGCCGAGCGCAAGATCAACGGCCGCATATACCGC
GACACCTTTACCGGCAAGGCCACCACCGATTGGCTCATGGACTGCTCCACCATTGTCGACCGCCGCGAGACGGTC
GAGATTGCCACCCTCTTCGTCGAGTACGGCCTCATCGAGGCCCTGGTTCAGGACAAGGTCTTCATTCAGCAGAAC
ACGGGCTACAACTTGTTCCAGCCCACGAAGCACTCCATCTACCAGCTGACGCAGCGCGGCAAGGACCTCATCAGC
GGAAACGGCTCCAGGGGCCGTGCCTCGGGCAGTGAGGGCGGCGCCGGATCTCAGCGCAACGGCATCTGCCGCGAC
TCCAACACGCAGCGGCTGGACAAGATTCTCACCGACCCGGCTCTCCGCCTGCTGTTCCGCGAGAACCTGCGCGAG
ACGCACTGCGAGGAGAACCTGTCGTTTTACCAGGACGTGACCGAATTCGTCCGCAGCTGCAAGGCGGCCATCCGA
CAGGCGCAAAAGTCGCCGACTGCCACGTCGATGGACTCGATCAAGGAGATCATGGCCCAGGCGTACGGCATCTAC
AACGCCTTCCTCGCGCCCGGCTCCCCTTGCGAGCTCAACATCGACCACCAGCTGCGAAACAACCTGGCGACGCGC
ATGACAAAGGCCGTCGGACAGGACAATTCGATGATCGACACGCTGCAGGAGGTGACGACGCTGTTCGAGGACGCT
CAGAATGCCGTGTTCAAGCTCATGGCCAGCGACTCGGTGCCCAAGTTCCTCCGCAACGCGAAATACGAGCAGCAG
CTCCGGATCCACGACCTCGACGTCAACGGCCGAATGCCCGAACGAAGTCAGAGCCGTTCCACGCGCCAGTGA
Gene >Ophcf2|02810
ATGGCAGCCATCTCGAATCCCCTCTCGACCGTCGCCTCGAAACCCTCTCTGTCAGCCAGGTCAGAGCTCCCGAAG
CGAAAACTCAGTCTGTCTACACCTCGCTCCTCCGTCTCGGAACGGTCCTCCGACCCGACGACAGCCGCCGCTCGT
CACTCGAGCAACCCGTCGGTCGGGTCCGCCTCGAACCGTTCCCAACGCAGCCTCCTGAATCGTGCCGTGGCCGCC
CTCGATCGCACCCAGAGCGCCTTCGCCAGCTTTTCCGACCCCGTCATCCGCCCCCGCCAGTCCGTTTCGGGCCTG
TCCCGACTCACGCCGCCCTCCTCCGAGCCTTCCAGCCCGGCCAAGAAGACCGAGTTCAAGGTGTCGACTAGCCCG
ACGTCGGCCCGAGGTCCCAGGCTCGACGACTGCCTGCCTGCCCCCGAAGAGTCGCCCGTCGGGCCCTGTCCGGAC
ACGCTCCTCCACCGTGCACCCACCCCGGTCAAGTCACAGCCTCTGGTCGACAGCAAGATGCACCAGACGTCTTCG
CGCTTGCTGCGCATGACCGACGATGATCGGCCTTTTACTAGGGTAAAAAAAACCTGGCAGCCCGCTCGGTGCTTG
TTCCCATCAGCGCTGACGCTTTGAGACAAAAAAAAGGACTTTAAGGATCTCTTTGCCACTCTCGTCGTCAGCTTG
CTCCCCCTCTCGGCACATCGCGTCCGCCTCTCCAAGGTCGAGTACACTTTTCTGTCTGAAGATGCCATCAACAAT
CTCGGCTCCCTCAAGTTCTCTCAATCGAACCGCATGCCGGACCCCAAAGACCCCTCTCGCATCGTCACCACCACG
ACGACCACTACCTTTTCCATGGCCAAGGACATGGCACGCTCCATCTGCCAGCGCTTCCTCGAGGCCCGCTTCATC
GAGTCGGCCGACGGCAAGTACCAGCAGGTCTACAACATGAAGGGCTCCGTCTGGCAGCTCACGCCCAAGGGCATC
ACCGTCCTCGACCGCTTCTGCTCCCGCAATGGCATCCAGCAGAAGCAGGTGGGCGAGCTCTCTAGCATAAATTCG
GCTCAGCTCGTCATCCTCGAGCGCGACCAGATATCGGACAAGCTCCTCAACGACCTCGGAACTATCGAAGTCATT
TTCCGCAGGTTCGTCGGCTCCGACGGCCGCAACCTCAAGGCCTCGCCCACGGCCGCCGACTCGGACTCGCTCCAC
GACTACCGCGACGGCCTCACCGGCGTCAAGATGGCCGCCGAGCGCAAGATCAACGGCCGCATATACCGCGACACC
TTTACCGGCAAGGCCACCACCGATTGGCTCATGGACTGCTCCACCATTGTCGACCGCCGCGAGACGGTCGAGATT
GCCACCCTCTTCGTCGAGTACGGCCTCATCGAGGCCCTGGTTCAGGACAAGGTCTTCATTCAGCAGAACACGGGC
TACAACTTGTTCCAGCCCACGAAGCACTCCATCTACCAGCTGACGCAGCGCGGCAAGGACCTCATCAGCGGAAAC
GGCTCCAGGGGCCGTGCCTCGGGCAGTGAGGGCGGCGCCGGATCTCAGCGCAACGGCATCTGCCGCGACTCCAAC
ACGCAGCGGCTGGACAAGATTCTCACCGACCCGGCTCTCCGCCTGCTGTTCCGCGAGAACCTGCGCGAGACGCAC
TGCGAGGAGAACCTGTCGTTTTACCAGGACGTGACCGAATTCGTCCGCAGCTGCAAGGCGGCCATCCGACAGGCG
CAAAAGTCGCCGACTGCCACGTCGATGGACTCGATCAAGGAGATCATGGCCCAGGCGTACGGCATCTACAACGCC
TTCCTCGCGCCCGGCTCCCCTTGCGAGCTCAACATCGACCACCAGCTGCGAAACAACCTGGCGACGCGCATGACA
AAGGCCGTCGGACAGGACAATTCGATGATCGACACGCTGCAGGAGGTGACGACGCTGTTCGAGGACGCTCAGAAT
GCCGTGTTCAAGCTCATGGCCAGCGTACGTTTTCCCACCCGGTAAAGAATCAACAGCAATACTAACGAGCATGTT
CAGGACTCGGTGCCCAAGTTCCTCCGCAACGCGAAATACGAGCAGCAGCTCCGGATCCACGACCTCGACGTCAAC
GGCCGAATGCCCGAACGAAGTCAGAGCCGTTCCACGCGCCAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail