Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02807
Gene name
Locationscaffold_02:4825008..4826203
Strand+
Gene length (bp)1195
Transcript length (bp)1125
Coding sequence length (bp)1125
Protein length (aa) 375

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00153 Mito_carr Mitochondrial carrier protein 1.1E-20 63 157
PF00153 Mito_carr Mitochondrial carrier protein 1.1E-16 164 259
PF00153 Mito_carr Mitochondrial carrier protein 4.5E-17 283 372

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

Domain # Start End Length
1 343 365 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 204.13 111.35 296.91
Alive In ants, during behavior modification 84.27 47.63 120.90
Dead In ants, recently dead 106.96 59.33 154.58

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.169268 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02807
MPSSPLPTGVFADSTSGLSRDPMHQVRQHNAGASLSPSAIGGVPAVCPTDEEALTPRKDKSSWDYVWKSGVAGGF
AGCAAKTVVAPLDRVKILFQASNPQFAKYTGSSFGVATALRDIYNAEGGFGLLRGHSATLLRIFPYAGIKFLAYE
QIRAVLIPSKEYETPLRRLLSGSLAGVTSVFFTYPLEVVRVRLAFETKSQGQSSLKSICRQMYNERRPGGQAAAG
LVNFYRGFVPTVLGMLPYAGTSFLTHDTVSDLLRHPSLAPHTTLPRSKNQPADKAAPLRSWAELCAGGMAGLVSQ
TASYPLEVIRRRMQVGGAVGDGRRLRLGETTALIFRERGLRGFFVGITIGYIKVIPMAAVSFYTYERSKLLLGI*
Coding >Ophcf2|02807
ATGCCGTCGTCTCCGTTGCCGACGGGTGTTTTCGCCGACAGCACGTCGGGTCTGTCCCGCGATCCGATGCATCAG
GTTCGACAGCACAATGCCGGAGCGTCCTTGTCCCCGTCGGCTATCGGGGGGGTGCCGGCAGTGTGTCCTACCGAC
GAGGAGGCTCTGACTCCGCGCAAAGACAAGAGCTCGTGGGATTATGTCTGGAAGTCGGGCGTTGCGGGCGGGTTT
GCCGGTTGCGCTGCCAAAACCGTCGTCGCGCCGCTAGATCGGGTCAAGATCCTCTTTCAGGCCAGCAACCCGCAG
TTTGCAAAGTACACAGGCTCGTCATTTGGCGTCGCAACGGCGCTGAGGGACATCTACAACGCCGAGGGCGGCTTC
GGCCTGTTACGCGGCCACTCGGCGACGCTGCTGCGCATCTTTCCCTACGCCGGCATCAAGTTTCTCGCCTACGAG
CAGATCCGGGCGGTGCTGATCCCGTCAAAGGAGTATGAGACACCGTTGAGGCGGTTGCTGAGCGGTAGCCTTGCT
GGCGTCACCTCCGTCTTCTTCACGTACCCGCTCGAGGTGGTGCGGGTGCGGCTCGCGTTTGAGACGAAATCACAG
GGCCAGTCGTCGTTAAAGTCCATCTGCCGGCAAATGTACAACGAGCGTCGACCAGGAGGCCAGGCGGCGGCAGGC
CTCGTCAACTTTTACCGCGGCTTCGTACCGACCGTTCTGGGCATGCTGCCGTACGCGGGGACGTCGTTTCTAACG
CACGACACCGTCAGCGACCTCCTGCGTCACCCGTCTCTGGCGCCGCACACGACGCTGCCGCGCAGCAAGAACCAG
CCAGCCGACAAGGCGGCTCCGCTGCGGTCGTGGGCGGAGCTGTGCGCCGGAGGGATGGCCGGCCTCGTCTCGCAG
ACGGCTTCGTACCCGCTCGAGGTGATCCGGAGGAGGATGCAGGTCGGGGGCGCCGTGGGTGATGGACGGCGCTTG
CGGCTGGGCGAGACGACGGCTCTCATCTTCCGGGAGAGGGGATTGCGCGGCTTCTTTGTCGGCATCACGATTGGA
TACATCAAGGTGATTCCCATGGCCGCCGTCAGCTTTTATACGTACGAGCGGTCCAAGCTGCTCTTGGGCATCTGA
Transcript >Ophcf2|02807
ATGCCGTCGTCTCCGTTGCCGACGGGTGTTTTCGCCGACAGCACGTCGGGTCTGTCCCGCGATCCGATGCATCAG
GTTCGACAGCACAATGCCGGAGCGTCCTTGTCCCCGTCGGCTATCGGGGGGGTGCCGGCAGTGTGTCCTACCGAC
GAGGAGGCTCTGACTCCGCGCAAAGACAAGAGCTCGTGGGATTATGTCTGGAAGTCGGGCGTTGCGGGCGGGTTT
GCCGGTTGCGCTGCCAAAACCGTCGTCGCGCCGCTAGATCGGGTCAAGATCCTCTTTCAGGCCAGCAACCCGCAG
TTTGCAAAGTACACAGGCTCGTCATTTGGCGTCGCAACGGCGCTGAGGGACATCTACAACGCCGAGGGCGGCTTC
GGCCTGTTACGCGGCCACTCGGCGACGCTGCTGCGCATCTTTCCCTACGCCGGCATCAAGTTTCTCGCCTACGAG
CAGATCCGGGCGGTGCTGATCCCGTCAAAGGAGTATGAGACACCGTTGAGGCGGTTGCTGAGCGGTAGCCTTGCT
GGCGTCACCTCCGTCTTCTTCACGTACCCGCTCGAGGTGGTGCGGGTGCGGCTCGCGTTTGAGACGAAATCACAG
GGCCAGTCGTCGTTAAAGTCCATCTGCCGGCAAATGTACAACGAGCGTCGACCAGGAGGCCAGGCGGCGGCAGGC
CTCGTCAACTTTTACCGCGGCTTCGTACCGACCGTTCTGGGCATGCTGCCGTACGCGGGGACGTCGTTTCTAACG
CACGACACCGTCAGCGACCTCCTGCGTCACCCGTCTCTGGCGCCGCACACGACGCTGCCGCGCAGCAAGAACCAG
CCAGCCGACAAGGCGGCTCCGCTGCGGTCGTGGGCGGAGCTGTGCGCCGGAGGGATGGCCGGCCTCGTCTCGCAG
ACGGCTTCGTACCCGCTCGAGGTGATCCGGAGGAGGATGCAGGTCGGGGGCGCCGTGGGTGATGGACGGCGCTTG
CGGCTGGGCGAGACGACGGCTCTCATCTTCCGGGAGAGGGGATTGCGCGGCTTCTTTGTCGGCATCACGATTGGA
TACATCAAGGTGATTCCCATGGCCGCCGTCAGCTTTTATACGTACGAGCGGTCCAAGCTGCTCTTGGGCATCTGA
Gene >Ophcf2|02807
ATGCCGTCGTCTCCGTTGCCGACGGGTGTTTTCGCCGACAGCACGTCGGGTCTGTCCCGCGATCCGATGCATCAG
GTTCGACAGCACAATGCCGGAGCGTCCTTGTCCCCGTCGGCTATCGGGGGGGTGCCGGCAGTGTGTCCTACCGAC
GAGGAGGCTCTGACTCCGCGCAAAGACAAGAGCTCGTGGGATTATGTCTGGAAGTCGGGCGTTGCGGGCGGGTTT
GCCGGTTGCGCTGTGAGTTGGAATTCGCTGCAGGGAGAGAAGATAAGGGAGTTGGCTGACGGGACTTGTTGCTCG
CTCGCAGGCCAAAACCGTCGTCGCGCCGCTAGATCGGGTCAAGATCCTCTTTCAGGCCAGCAACCCGCAGTTTGC
AAAGTACACAGGCTCGTCATTTGGCGTCGCAACGGCGCTGAGGGACATCTACAACGCCGAGGGCGGCTTCGGCCT
GTTACGCGGCCACTCGGCGACGCTGCTGCGCATCTTTCCCTACGCCGGCATCAAGTTTCTCGCCTACGAGCAGAT
CCGGGCGGTGCTGATCCCGTCAAAGGAGTATGAGACACCGTTGAGGCGGTTGCTGAGCGGTAGCCTTGCTGGCGT
CACCTCCGTCTTCTTCACGTACCCGCTCGAGGTGGTGCGGGTGCGGCTCGCGTTTGAGACGAAATCACAGGGCCA
GTCGTCGTTAAAGTCCATCTGCCGGCAAATGTACAACGAGCGTCGACCAGGAGGCCAGGCGGCGGCAGGCCTCGT
CAACTTTTACCGCGGCTTCGTACCGACCGTTCTGGGCATGCTGCCGTACGCGGGGACGTCGTTTCTAACGCACGA
CACCGTCAGCGACCTCCTGCGTCACCCGTCTCTGGCGCCGCACACGACGCTGCCGCGCAGCAAGAACCAGCCAGC
CGACAAGGCGGCTCCGCTGCGGTCGTGGGCGGAGCTGTGCGCCGGAGGGATGGCCGGCCTCGTCTCGCAGACGGC
TTCGTACCCGCTCGAGGTGATCCGGAGGAGGATGCAGGTCGGGGGCGCCGTGGGTGATGGACGGCGCTTGCGGCT
GGGCGAGACGACGGCTCTCATCTTCCGGGAGAGGGGATTGCGCGGCTTCTTTGTCGGCATCACGATTGGATACAT
CAAGGTGATTCCCATGGCCGCCGTCAGCTTTTATACGTACGAGCGGTCCAAGCTGCTCTTGGGCATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail