Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02800
Gene name
Locationscaffold_02:4809884..4810488
Strand+
Gene length (bp)604
Transcript length (bp)432
Coding sequence length (bp)432
Protein length (aa) 144

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein 1.2E-21 17 133

GO

GO Term Description Terminal node
GO:0003779 actin binding Yes
GO:0003674 molecular_function No
GO:0008092 cytoskeletal protein binding No
GO:0005488 binding No
GO:0005515 protein binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6722 0.6443 0.0188 0.0869 0.0745 0.0062 0.1098 0.1167 0.0408 0.001

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2078
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4406
Ophiocordyceps australis map64 (Brazil) OphauB2|1208
Ophiocordyceps camponoti-floridani Ophcf2|02800 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4565
Ophiocordyceps kimflemingae Ophio5|3713
Ophiocordyceps subramaniannii Hirsu2|2405

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02800
MASESRLFKFSGETKDHLRKFRLTTSRSKEPQAVIYMIDKNTHEIRQDDDKTVYKTLDEVAEDLPDHAPRFILLS
YPLTLPDGRMSVPYVLLYYLPNTCNAEVRMLYAGAKELMRNTSEVGKVIDIESAEDLEQIPGKLGSGI*
Coding >Ophcf2|02800
ATGGCATCCGAGTCGAGGCTCTTCAAGTTCTCGGGCGAGACCAAAGACCACCTGCGCAAGTTTCGTCTGACGACT
TCGCGGTCCAAAGAGCCTCAAGCCGTTATATACATGATCGATAAGAACACGCACGAGATCCGCCAGGACGACGAC
AAGACCGTCTACAAGACGCTCGACGAAGTCGCAGAAGACCTGCCAGACCATGCGCCTCGCTTCATCCTGCTGAGC
TACCCTCTCACGCTGCCCGATGGCCGCATGTCGGTGCCATACGTGCTGCTCTATTACCTGCCCAACACCTGCAAC
GCCGAGGTCCGCATGCTGTACGCTGGCGCTAAGGAGTTGATGCGGAACACAAGCGAGGTCGGCAAGGTTATCGAC
ATCGAGTCTGCTGAGGATCTGGAGCAGATTCCGGGCAAGTTGGGATCTGGGATCTGA
Transcript >Ophcf2|02800
ATGGCATCCGAGTCGAGGCTCTTCAAGTTCTCGGGCGAGACCAAAGACCACCTGCGCAAGTTTCGTCTGACGACT
TCGCGGTCCAAAGAGCCTCAAGCCGTTATATACATGATCGATAAGAACACGCACGAGATCCGCCAGGACGACGAC
AAGACCGTCTACAAGACGCTCGACGAAGTCGCAGAAGACCTGCCAGACCATGCGCCTCGCTTCATCCTGCTGAGC
TACCCTCTCACGCTGCCCGATGGCCGCATGTCGGTGCCATACGTGCTGCTCTATTACCTGCCCAACACCTGCAAC
GCCGAGGTCCGCATGCTGTACGCTGGCGCTAAGGAGTTGATGCGGAACACAAGCGAGGTCGGCAAGGTTATCGAC
ATCGAGTCTGCTGAGGATCTGGAGCAGATTCCGGGCAAGTTGGGATCTGGGATCTGA
Gene >Ophcf2|02800
ATGGTACTCCTCCCCTCTCCCCTCTCTCTAGAACCTCACCCGCTGACAAGCCCAGGCATCCGAGTCGAGGCTCTT
CAAGTTCTCGGGCGAGACCAAAGACCACCTGCGCAAGTTTCGTCTGACGACTTCGCGGTCCAAAGAGCCTCAAGC
CGTTATATGTGCGTCAGCAATCCCGACTTGGACTTCGTTCTCCAGCTAACGAAGAAACTCCAGACATGATCGATA
AGAACACGCACGAGATCCGCCAGGACGACGACAAGACCGTCTACAAGACGCTCGACGAAGTCGCAGAAGACCTGC
CAGACCATGCGCCTCGCTTCATCCTGCTGAGCTACCCTCTCACGCTGGTACGTCGTCCTGCCCGGTGCCACCCCT
TGCGAATACCGCCACTGACGTGCGCGACGCCACGTAGCCCGATGGCCGCATGTCGGTGCCATACGTGCTGCTCTA
TTACCTGCCCAACACCTGCAACGCCGAGGTCCGCATGCTGTACGCTGGCGCTAAGGAGTTGATGCGGAACACAAG
CGAGGTCGGCAAGGTTATCGACATCGAGTCTGCTGAGGATCTGGAGCAGATTCCGGGCAAGTTGGGATCTGGGAT
CTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail