Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02794
Gene name
Locationscaffold_02:4786553..4789470
Strand-
Gene length (bp)2917
Transcript length (bp)2772
Coding sequence length (bp)2772
Protein length (aa) 924

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 2.3E-198 168 881

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:1904680 peptide transmembrane transporter activity No
GO:0042887 amide transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

Domain # Start End Length
1 197 219 22
2 253 272 19
3 282 301 19
4 308 330 22
5 350 372 22
6 384 406 22
7 421 443 22
8 602 621 19
9 631 653 22
10 666 688 22
11 714 736 22
12 783 802 19
13 825 847 22
14 868 890 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02794
MPHPPRKSPSFLLAAQGTGRNGYAYGSVASAGDGDGDDAHPLRNVHDSFRSRRSMSSRRSHISWQSSSRHSEDLD
GAALASGLESRFSLVEAPLLGEILDDNDNDNDNAATRGRTSQSEGDDDDDEDDDDDDDDDDYDSQSYSSRDDSPP
EAVRASVPPTDNTTLSINTPRMWCLSVLFSILGSSTNLFFSLRYPSVAITPVIALLLVHPLGHLWDLLLKRPHDA
QQEFVDGKLDSWRQWLAQGRWNEKEHTCVYVSSNVAFGFAFATDVIVEQTRFYQQEAPIIYQLLLTISTQILGYG
FAGMARRFLVRPSGMIWPGTLMSAAMFSTLHRQDNKPADGWTISRWNFFYIVWGASFAFYFLPGLLFPALSYFNV
ITWFAPRNVIVANLFGVSSGLGLFPVTLDWAQITYVGSPLLVPFWAAMNVIGGLVIVMWITAPLLYYTNVLYTSY
MPMLSSAVFDNTGSVYNVSKILTPDFLFDREAYSRYSRVFLPVTYALSYGVQFAALAALLTHTLCWHGPDIWRTI
RRSLAEARRRRPDANPGVDATAYHPVNDDAPSSAASASFPSPAGDDGGVSDSASNADGLLSREDVHCRLMNRYRD
APLTWYLLTFASMTAMGMFVVEYYPVHLPWYGLLLALSIGAIFFIPNGIIMAITNQHSSTYLICQLICGVVFPGR
PIANMVFVTYGYISSAQGIKFAADLKLGHYMKIPPRLMFIVQVVATLVSSLTQIGVLNWMFANVKGLCTADAVNG
FTCPIARVHFNGSILWGVVGPAEFFGRDAIYRALVWCFPLGFLLPIPLWLYARNRKGSPVGKVNLPVLLGAMSWI
PPATGLNFSVWALVCYLFNYVLRRRANAWWAKYTMTLSAALDSGLAFGILVVFFAFVYPGWMAGFHWWGTDVYKQ
GCDWKACAWRTVPQGETFGPHTW*
Coding >Ophcf2|02794
ATGCCACATCCGCCCCGCAAGTCGCCGTCGTTTCTTCTCGCAGCCCAAGGCACAGGCCGCAACGGCTATGCCTAT
GGCTCCGTTGCCTCGGCTGGAGACGGCGACGGCGACGACGCCCATCCGCTGCGAAACGTCCACGATAGCTTCAGG
AGTCGACGGAGTATGAGCTCCAGGCGATCCCATATCTCGTGGCAGTCGTCTTCACGCCATTCCGAAGATCTCGAC
GGTGCTGCCCTAGCGTCGGGCCTCGAGAGTCGCTTCAGCCTGGTTGAGGCTCCTCTTCTCGGCGAGATACTCGAC
GACAACGACAACGACAACGACAACGCCGCTACCCGCGGCCGCACTTCACAGTCCGAAGGCGACGACGACGACGAC
GAAGACGACGACGACGACGACGACGACGACGACTACGACTCCCAATCATACTCTTCCCGCGATGACTCCCCCCCG
GAAGCCGTCCGGGCCTCAGTCCCTCCAACCGACAACACAACTCTCTCCATCAACACCCCCCGAATGTGGTGTCTC
TCCGTCCTCTTCTCCATCCTCGGCTCCTCCACCAACCTCTTCTTCTCCCTACGATACCCAAGCGTCGCCATCACC
CCCGTCATCGCCCTGCTCCTCGTCCACCCCCTCGGCCACCTATGGGACCTCCTCCTCAAGCGGCCCCACGACGCC
CAACAAGAATTCGTCGACGGCAAGCTCGACTCCTGGCGGCAATGGCTCGCTCAGGGTCGATGGAACGAAAAGGAG
CACACGTGCGTCTACGTCAGCAGCAACGTCGCCTTTGGCTTCGCCTTCGCCACGGACGTCATCGTCGAACAAACG
CGCTTCTACCAACAGGAAGCCCCCATCATCTACCAACTCCTCTTGACCATATCGACGCAGATCCTCGGCTACGGC
TTCGCCGGCATGGCCCGCCGATTCCTCGTCCGACCCAGCGGCATGATCTGGCCCGGAACCCTCATGTCGGCCGCC
ATGTTCTCAACCCTCCACCGACAAGACAACAAGCCGGCAGACGGCTGGACCATCAGCCGCTGGAACTTCTTCTAC
ATCGTCTGGGGCGCCTCCTTCGCCTTCTACTTCCTCCCAGGCCTCCTCTTCCCAGCACTGAGCTACTTCAACGTC
ATAACGTGGTTCGCGCCGCGAAACGTCATCGTCGCCAACCTCTTCGGCGTCTCGTCCGGCCTCGGCCTCTTCCCC
GTAACCTTGGACTGGGCCCAAATCACATACGTCGGCTCCCCCTTACTGGTCCCCTTCTGGGCAGCCATGAACGTC
ATCGGCGGCCTCGTCATCGTCATGTGGATCACGGCACCGCTGCTCTACTACACAAACGTCCTCTACACCTCCTAC
ATGCCCATGCTGTCCTCTGCCGTCTTCGACAACACAGGCTCCGTCTACAACGTCAGCAAGATCCTCACGCCCGAC
TTCCTCTTCGACCGCGAAGCCTACTCCCGCTACAGCCGCGTCTTCCTACCCGTCACCTACGCCCTCAGCTACGGC
GTCCAGTTCGCCGCTCTCGCCGCCCTGCTGACCCACACGCTCTGCTGGCACGGTCCCGACATCTGGCGCACCATC
CGCAGGAGCCTCGCCGAAGCCCGTCGTCGCCGCCCCGATGCCAACCCCGGCGTCGATGCCACCGCCTATCACCCC
GTCAACGACGATGCTCCCTCCTCGGCAGCATCGGCCTCGTTCCCATCTCCCGCCGGAGACGACGGCGGCGTGTCC
GACTCGGCCTCCAACGCCGACGGCCTCCTCAGCCGCGAAGACGTCCACTGCCGCCTCATGAACCGTTACCGCGAC
GCACCCCTGACCTGGTACCTCCTAACCTTTGCCTCCATGACCGCCATGGGCATGTTCGTCGTCGAATACTACCCA
GTCCACCTCCCATGGTACGGCCTCCTCCTCGCCCTCTCCATCGGCGCCATCTTCTTCATCCCCAACGGCATCATC
ATGGCCATCACCAACCAACACAGCAGCACCTACCTAATCTGCCAACTCATCTGCGGCGTCGTCTTCCCCGGCCGC
CCCATAGCAAACATGGTCTTCGTAACGTACGGATACATCTCTTCCGCCCAGGGCATCAAATTCGCAGCAGACCTC
AAACTGGGACACTACATGAAGATCCCCCCAAGACTCATGTTCATCGTCCAGGTCGTCGCCACGCTCGTCTCGTCC
CTCACCCAGATAGGCGTCCTCAACTGGATGTTCGCCAACGTCAAGGGCTTATGCACCGCCGACGCCGTCAACGGC
TTCACCTGCCCCATCGCACGCGTCCATTTCAACGGCTCCATCCTCTGGGGCGTCGTCGGACCCGCCGAGTTCTTC
GGCCGAGACGCCATCTACCGCGCCCTGGTGTGGTGCTTCCCCCTAGGATTCCTCCTCCCCATCCCCCTCTGGCTC
TACGCCCGCAACCGCAAAGGCAGCCCCGTCGGCAAGGTCAACCTCCCCGTCCTCCTCGGCGCCATGTCCTGGATC
CCCCCGGCCACGGGCCTCAACTTCTCCGTCTGGGCCCTCGTCTGCTACCTCTTCAACTACGTCCTCCGCCGCCGC
GCCAACGCCTGGTGGGCAAAGTACACCATGACCCTCAGCGCCGCCCTCGACTCGGGCCTCGCTTTCGGAATCCTC
GTCGTCTTCTTCGCCTTCGTCTACCCCGGTTGGATGGCTGGCTTTCACTGGTGGGGGACCGACGTCTACAAGCAG
GGTTGTGACTGGAAGGCCTGCGCTTGGAGGACTGTTCCCCAAGGCGAGACGTTTGGACCGCATACTTGGTGA
Transcript >Ophcf2|02794
ATGCCACATCCGCCCCGCAAGTCGCCGTCGTTTCTTCTCGCAGCCCAAGGCACAGGCCGCAACGGCTATGCCTAT
GGCTCCGTTGCCTCGGCTGGAGACGGCGACGGCGACGACGCCCATCCGCTGCGAAACGTCCACGATAGCTTCAGG
AGTCGACGGAGTATGAGCTCCAGGCGATCCCATATCTCGTGGCAGTCGTCTTCACGCCATTCCGAAGATCTCGAC
GGTGCTGCCCTAGCGTCGGGCCTCGAGAGTCGCTTCAGCCTGGTTGAGGCTCCTCTTCTCGGCGAGATACTCGAC
GACAACGACAACGACAACGACAACGCCGCTACCCGCGGCCGCACTTCACAGTCCGAAGGCGACGACGACGACGAC
GAAGACGACGACGACGACGACGACGACGACGACTACGACTCCCAATCATACTCTTCCCGCGATGACTCCCCCCCG
GAAGCCGTCCGGGCCTCAGTCCCTCCAACCGACAACACAACTCTCTCCATCAACACCCCCCGAATGTGGTGTCTC
TCCGTCCTCTTCTCCATCCTCGGCTCCTCCACCAACCTCTTCTTCTCCCTACGATACCCAAGCGTCGCCATCACC
CCCGTCATCGCCCTGCTCCTCGTCCACCCCCTCGGCCACCTATGGGACCTCCTCCTCAAGCGGCCCCACGACGCC
CAACAAGAATTCGTCGACGGCAAGCTCGACTCCTGGCGGCAATGGCTCGCTCAGGGTCGATGGAACGAAAAGGAG
CACACGTGCGTCTACGTCAGCAGCAACGTCGCCTTTGGCTTCGCCTTCGCCACGGACGTCATCGTCGAACAAACG
CGCTTCTACCAACAGGAAGCCCCCATCATCTACCAACTCCTCTTGACCATATCGACGCAGATCCTCGGCTACGGC
TTCGCCGGCATGGCCCGCCGATTCCTCGTCCGACCCAGCGGCATGATCTGGCCCGGAACCCTCATGTCGGCCGCC
ATGTTCTCAACCCTCCACCGACAAGACAACAAGCCGGCAGACGGCTGGACCATCAGCCGCTGGAACTTCTTCTAC
ATCGTCTGGGGCGCCTCCTTCGCCTTCTACTTCCTCCCAGGCCTCCTCTTCCCAGCACTGAGCTACTTCAACGTC
ATAACGTGGTTCGCGCCGCGAAACGTCATCGTCGCCAACCTCTTCGGCGTCTCGTCCGGCCTCGGCCTCTTCCCC
GTAACCTTGGACTGGGCCCAAATCACATACGTCGGCTCCCCCTTACTGGTCCCCTTCTGGGCAGCCATGAACGTC
ATCGGCGGCCTCGTCATCGTCATGTGGATCACGGCACCGCTGCTCTACTACACAAACGTCCTCTACACCTCCTAC
ATGCCCATGCTGTCCTCTGCCGTCTTCGACAACACAGGCTCCGTCTACAACGTCAGCAAGATCCTCACGCCCGAC
TTCCTCTTCGACCGCGAAGCCTACTCCCGCTACAGCCGCGTCTTCCTACCCGTCACCTACGCCCTCAGCTACGGC
GTCCAGTTCGCCGCTCTCGCCGCCCTGCTGACCCACACGCTCTGCTGGCACGGTCCCGACATCTGGCGCACCATC
CGCAGGAGCCTCGCCGAAGCCCGTCGTCGCCGCCCCGATGCCAACCCCGGCGTCGATGCCACCGCCTATCACCCC
GTCAACGACGATGCTCCCTCCTCGGCAGCATCGGCCTCGTTCCCATCTCCCGCCGGAGACGACGGCGGCGTGTCC
GACTCGGCCTCCAACGCCGACGGCCTCCTCAGCCGCGAAGACGTCCACTGCCGCCTCATGAACCGTTACCGCGAC
GCACCCCTGACCTGGTACCTCCTAACCTTTGCCTCCATGACCGCCATGGGCATGTTCGTCGTCGAATACTACCCA
GTCCACCTCCCATGGTACGGCCTCCTCCTCGCCCTCTCCATCGGCGCCATCTTCTTCATCCCCAACGGCATCATC
ATGGCCATCACCAACCAACACAGCAGCACCTACCTAATCTGCCAACTCATCTGCGGCGTCGTCTTCCCCGGCCGC
CCCATAGCAAACATGGTCTTCGTAACGTACGGATACATCTCTTCCGCCCAGGGCATCAAATTCGCAGCAGACCTC
AAACTGGGACACTACATGAAGATCCCCCCAAGACTCATGTTCATCGTCCAGGTCGTCGCCACGCTCGTCTCGTCC
CTCACCCAGATAGGCGTCCTCAACTGGATGTTCGCCAACGTCAAGGGCTTATGCACCGCCGACGCCGTCAACGGC
TTCACCTGCCCCATCGCACGCGTCCATTTCAACGGCTCCATCCTCTGGGGCGTCGTCGGACCCGCCGAGTTCTTC
GGCCGAGACGCCATCTACCGCGCCCTGGTGTGGTGCTTCCCCCTAGGATTCCTCCTCCCCATCCCCCTCTGGCTC
TACGCCCGCAACCGCAAAGGCAGCCCCGTCGGCAAGGTCAACCTCCCCGTCCTCCTCGGCGCCATGTCCTGGATC
CCCCCGGCCACGGGCCTCAACTTCTCCGTCTGGGCCCTCGTCTGCTACCTCTTCAACTACGTCCTCCGCCGCCGC
GCCAACGCCTGGTGGGCAAAGTACACCATGACCCTCAGCGCCGCCCTCGACTCGGGCCTCGCTTTCGGAATCCTC
GTCGTCTTCTTCGCCTTCGTCTACCCCGGTTGGATGGCTGGCTTTCACTGGTGGGGGACCGACGTCTACAAGCAG
GGTTGTGACTGGAAGGCCTGCGCTTGGAGGACTGTTCCCCAAGGCGAGACGTTTGGACCGCATACTTGGTGA
Gene >Ophcf2|02794
ATGCCACATCCGCCCCGCAAGTCGCCGTCGTTTCTTCTCGCAGCCCAAGGCACAGGCCGCAACGGCTATGCCTAT
GGCTCCGTTGCCTCGGCTGGAGACGGCGACGGCGACGACGCCCATCCGCTGCGAAACGTCCACGATAGCTTCAGG
AGTCGACGGAGTATGAGCTCCAGGCGATCCCATATCTCGTGGCAGTCGTCTTCACGCCATTCCGAAGATCTCGAC
GGTGCTGCCCTAGCGTCGGGCCTCGAGAGTCGCTTCAGCCTGGTTGAGGCTCCTCTTCTCGGCGAGATACTCGAC
GACAACGACAACGACAACGACAACGCCGCTACCCGCGGCCGCACTTCACAGTCCGAAGGCGACGACGACGACGAC
GAAGACGACGACGACGACGACGACGACGACGACTACGACTCCCAATCATACTCTTCCCGCGATGACTCCCCCCCG
GAAGCCGTCCGGGCCTCAGTCCCTCCAACCGACAACACAACTCTCTCCATCAACACCCCCCGAATGTGGTGTCTC
TCCGTCCTCTTCTCCATCCTCGGCTCCTCCACCAACCTCTTCTTCTCCCTACGATACCCAAGCGTCGCCATCACC
CCCGTCATCGCCCTGCTCCTCGTCCACCCCCTCGGCCACCTATGGGACCTCCTCCTCAAGCGGCCCCACGACGCC
CAACAAGAATTCGTCGACGGCGTCCGCGTCCCCCGTCCGCCCCCCCGTCGACAGCCTCCGCCCCCAGAAGCTCGA
CTCCTGGCGGCAATGGCTCGCTCAGGGTCGATGGAACGAAAAGGAGCACACGTGCGTCTACGTCAGCAGCAACGT
CGCCTTTGGCTTCGCCTTCGCCACGGACGTCATCGTCGAACAAACGCGCTTCTACCAACAGGAAGCCCCCATCAT
CTACCAACTCCTCTTGACCATATCGACGCAGATCCTCGGCTACGGCTTCGCCGGCATGGCCCGCCGATTCCTCGT
CCGACCCAGCGGCATGATCTGGCCCGGAACCCTCATGTCGGCCGCCATGTTCTCAACCCTCCACCGACAAGACAA
CAAGCCGGCAGACGGCTGGACCATCAGCCGCTGGAACTTCTTCTACATCGTCTGGGGCGCCTCCTTCGCCTTCTA
CTTCCTCCCAGGCCTCCTCTTCCCAGCACTGAGCTACTTCAACGTCATAACGTGGTTCGCGCCGCGAAACGTCAT
CGTCGCCAACCTCTTCGGCGTCTCGTCCGGCCTCGGCCTCTTCCCCGTAACCTTGGACTGGGCCCAAATCACATA
CGTCGGCTCCCCCTTACTGGTCCCCTTCTGGGCAGCCATGAACGTCATCGGCGGCCTCGTCATCGTCATGTGGAT
CACGGCACCGCTGCTCTACTACACAAACGTCCTCTACACCTCCTACATGCCCATGCTGTCCTCTGCCGTCTTCGA
CAACACAGGCTCCGTCTACAACGTCAGCAAGATCCTCACGCCCGACTTCCTCTTCGACCGCGAAGCCTACTCCCG
CTACAGCCGCGTCTTCCTACCCGTCACCTACGCCCTCAGCTACGGCGTCCAGTTCGCCGCTCTCGCCGCCCTGCT
GACCCACACGCTCTGCTGGCACGGTCCCGACATCTGGCGCACCATCCGCAGGAGCCTCGCCGAAGCCCGTCGTCG
CCGCCCCGATGCCAACCCCGGCGTCGATGCCACCGCCTATCACCCCGTCAACGACGATGCTCCCTCCTCGGCAGC
ATCGGCCTCGTTCCCATCTCCCGCCGGAGACGACGGCGGCGTGTCCGACTCGGCCTCCAACGCCGACGGCCTCCT
CAGCCGCGAAGACGTCCACTGCCGCCTCATGAACCGTTACCGCGACGCACCCCTGACCTGGTACCTCCTAACCTT
TGCCTCCATGACCGCCATGGGCATGTTCGTCGTCGAATAGTGAGTCCAATCCACCGGCCTCCCCCCCCCCTCCTA
AACCAACCAACCAACCAACCCATCTAGCTGACCACTCTCCAAACCCCCCCCCCCCCCCATAAGCTACCCAGTCCA
CCTCCCATGGTACGGCCTCCTCCTCGCCCTCTCCATCGGCGCCATCTTCTTCATCCCCAACGGCATCATCATGGC
CATCACCAACCAACACAGCAGCACCTACCTAATCTGCCAACTCATCTGCGGCGTCGTCTTCCCCGGCCGCCCCAT
AGCAAACATGGTCTTCGTAACGTACGGATACATCTCTTCCGCCCAGGGCATCAAATTCGCAGCAGACCTCAAACT
GGGACACTACATGAAGATCCCCCCAAGACTCATGTTCATCGTCCAGGTCGTCGCCACGCTCGTCTCGTCCCTCAC
CCAGATAGGCGTCCTCAACTGGATGTTCGCCAACGTCAAGGGCTTATGCACCGCCGACGCCGTCAACGGCTTCAC
CTGCCCCATCGCACGCGTCCATTTCAACGGCTCCATCCTCTGGGGCGTCGTCGGACCCGCCGAGTTCTTCGGCCG
AGACGCCATCTACCGCGCCCTGGTGTGGTGCTTCCCCCTAGGATTCCTCCTCCCCATCCCCCTCTGGCTCTACGC
CCGCAACCGCAAAGGCAGCCCCGTCGGCAAGGTCAACCTCCCCGTCCTCCTCGGCGCCATGTCCTGGATCCCCCC
GGCCACGGGCCTCAACTTCTCCGTCTGGGCCCTCGTCTGCTACCTCTTCAACTACGTCCTCCGCCGCCGCGCCAA
CGCCTGGTGGGCAAAGTACACCATGACCCTCAGCGCCGCCCTCGACTCGGGCCTCGCTTTCGGAATCCTCGTCGT
CTTCTTCGCCTTCGTCTACCCCGGTTGGATGGCTGGCTTTCACTGGTGGGGGACCGACGTCTACAAGCAGGGTTG
TGACTGGAAGGCCTGCGCTTGGAGGACTGTTCCCCAAGGCGAGACGTTTGGACCGCATACTTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail