Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02790
Gene name
Locationscaffold_02:4773446..4775706
Strand+
Gene length (bp)2260
Transcript length (bp)2079
Coding sequence length (bp)2079
Protein length (aa) 693

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00667 FAD_binding_1 FAD binding domain 2.4E-60 269 488
PF00258 Flavodoxin_1 Flavodoxin 5.0E-34 67 212
PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain 4.5E-19 544 654

GO

GO Term Description Terminal node
GO:0010181 FMN binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:1901265 nucleoside phosphate binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 127.70 67.76 187.65
Alive In ants, during behavior modification 308.56 141.28 475.84
Dead In ants, recently dead 146.43 73.48 219.37

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.000238 yes
Dead Fungus 0.562399 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02790
MAALDTLDVVVLVALLVGTVAYFTKGTYWGVVKDPYANAFANANGSVPGRTRNIVEKMEESGKNCVVFYGSQTGT
AEDYASRLAKEGKSRFGLETMVADLEEYDFDNLDTFPSDKVCMFVLATYGEGEPTDNAVDFYEFISAEDVSLSES
NDPPLGNLNYVAFGLGNNTYEHYNSMVRNVDKALAKLGAHRVGDAGEGDDGAGTMEEDFLAWKDPMWAALASKLG
LEEREAIYEPTFELIYRSELTPESSQVYLGELNKMHLEGSAKGPFNAHNPYIAPIVASRELFSAKDRNCIHMDID
VSSSNLTYQTGDHIAVWPTNPGDEVDRFLDVVGLGDSRHKVVSVKALEPTAKVPFPTPTTFDAIVRYHLEICAPV
SRQFLFTLAPFSPNDDIRIEMTRLGSDKDYFHQKTGPNYYNIARLLAAVGKGERWTKIPFSAFIEGLNKLQPRYY
SISSSSLVSPKVISITAVVESQAIPGRDGPFRGVATNYLLALKQRQNGDPNPEPFGQSYEINGPRNRYDGIHVPV
HVRHSNFKLPSDPSKPIIMIGPGTGVAPFRGFVQERAKQAQNGVPVGRTLLFFGCRKRAEDFMYEQEWEECKKML
GDNFEMITAFSRDGNKKVYVQHRLKERARDVNDLLSQKAYFYVCGDAANMAREVNTVLAQIIAEARGVSEQKGEE
VVKHMRAANQYQEDVWS*
Coding >Ophcf2|02790
ATGGCTGCCCTCGACACGCTCGATGTCGTCGTCCTCGTCGCTCTTCTCGTCGGCACCGTCGCCTACTTCACAAAG
GGTACCTACTGGGGCGTCGTCAAGGACCCCTACGCCAATGCCTTTGCCAACGCCAATGGCTCCGTTCCGGGCCGC
ACCCGCAACATCGTCGAAAAGATGGAGGAGTCTGGCAAGAACTGCGTCGTATTCTACGGCTCGCAGACCGGAACC
GCCGAGGACTACGCCTCACGACTCGCAAAGGAGGGCAAAAGCCGCTTTGGTCTCGAGACAATGGTCGCCGACCTC
GAAGAGTATGACTTTGACAACCTAGACACTTTCCCGTCCGACAAGGTCTGCATGTTCGTCCTGGCTACATACGGC
GAAGGCGAGCCGACAGACAACGCCGTCGACTTTTACGAATTCATCTCGGCCGAAGACGTGTCTCTGTCGGAGAGC
AACGACCCGCCTCTTGGTAACCTCAACTACGTCGCATTCGGACTCGGCAACAATACGTACGAGCACTACAACTCC
ATGGTCCGCAACGTCGACAAGGCCCTTGCGAAGCTCGGCGCCCACCGAGTCGGCGATGCCGGTGAGGGCGACGAC
GGTGCCGGCACAATGGAGGAGGACTTCTTGGCCTGGAAGGATCCCATGTGGGCTGCTCTGGCCAGCAAGTTGGGT
CTGGAGGAGCGCGAGGCCATCTACGAGCCAACGTTTGAGCTCATCTACCGTTCCGAGCTGACGCCCGAAAGCAGC
CAGGTCTATCTGGGCGAGCTTAACAAGATGCACCTCGAGGGCTCGGCCAAGGGTCCCTTCAACGCGCATAACCCC
TACATCGCCCCCATCGTCGCCTCCCGCGAGCTCTTCTCAGCAAAGGACCGCAACTGCATCCATATGGACATCGAC
GTCAGCAGTTCCAACTTGACGTATCAGACTGGCGACCACATCGCCGTCTGGCCGACCAACCCAGGTGACGAGGTC
GACCGCTTTCTCGACGTCGTCGGCCTTGGCGACTCGCGGCACAAGGTCGTCAGCGTCAAGGCGCTGGAGCCGACG
GCCAAGGTTCCTTTCCCCACGCCTACGACGTTCGACGCCATCGTCCGCTACCACCTCGAGATCTGCGCGCCCGTC
TCGCGCCAGTTCCTCTTCACGCTCGCCCCTTTCTCTCCCAACGACGATATCCGGATCGAGATGACGAGACTCGGC
AGCGACAAGGATTACTTCCATCAGAAGACGGGACCCAACTACTACAACATCGCCCGCCTCCTGGCCGCTGTCGGT
AAGGGCGAGCGCTGGACCAAGATCCCCTTCTCGGCCTTCATCGAGGGCCTCAACAAGCTTCAGCCGCGGTACTAC
TCCATCTCGTCCTCGTCACTCGTCTCGCCCAAGGTCATCTCCATCACGGCCGTCGTCGAGTCGCAAGCGATTCCC
GGCCGCGACGGACCTTTCCGCGGCGTCGCGACAAACTACCTACTCGCGCTCAAGCAGCGCCAGAACGGAGACCCG
AACCCGGAACCATTCGGGCAGTCGTACGAGATCAACGGCCCGCGCAACCGGTACGACGGCATTCACGTGCCCGTT
CACGTGCGCCACTCCAACTTCAAGCTACCCTCGGACCCGAGCAAGCCCATCATCATGATCGGTCCGGGCACCGGC
GTCGCCCCCTTCCGCGGCTTCGTCCAGGAACGCGCCAAGCAAGCCCAGAACGGCGTTCCCGTCGGCCGAACCCTG
CTCTTCTTTGGCTGCCGAAAGCGTGCCGAGGATTTCATGTATGAGCAGGAGTGGGAGGAATGTAAAAAGATGCTC
GGCGACAACTTTGAGATGATCACGGCCTTTTCTCGCGACGGCAACAAGAAGGTCTACGTCCAACATCGTCTCAAG
GAACGCGCCCGTGACGTCAACGACCTCCTTTCCCAAAAGGCTTACTTCTACGTCTGCGGCGACGCGGCGAACATG
GCGCGCGAGGTCAACACCGTCCTGGCTCAGATCATTGCCGAGGCCCGCGGCGTATCGGAGCAAAAGGGCGAGGAG
GTTGTCAAGCACATGAGGGCCGCGAATCAATATCAGGAAGACGTCTGGTCATGA
Transcript >Ophcf2|02790
ATGGCTGCCCTCGACACGCTCGATGTCGTCGTCCTCGTCGCTCTTCTCGTCGGCACCGTCGCCTACTTCACAAAG
GGTACCTACTGGGGCGTCGTCAAGGACCCCTACGCCAATGCCTTTGCCAACGCCAATGGCTCCGTTCCGGGCCGC
ACCCGCAACATCGTCGAAAAGATGGAGGAGTCTGGCAAGAACTGCGTCGTATTCTACGGCTCGCAGACCGGAACC
GCCGAGGACTACGCCTCACGACTCGCAAAGGAGGGCAAAAGCCGCTTTGGTCTCGAGACAATGGTCGCCGACCTC
GAAGAGTATGACTTTGACAACCTAGACACTTTCCCGTCCGACAAGGTCTGCATGTTCGTCCTGGCTACATACGGC
GAAGGCGAGCCGACAGACAACGCCGTCGACTTTTACGAATTCATCTCGGCCGAAGACGTGTCTCTGTCGGAGAGC
AACGACCCGCCTCTTGGTAACCTCAACTACGTCGCATTCGGACTCGGCAACAATACGTACGAGCACTACAACTCC
ATGGTCCGCAACGTCGACAAGGCCCTTGCGAAGCTCGGCGCCCACCGAGTCGGCGATGCCGGTGAGGGCGACGAC
GGTGCCGGCACAATGGAGGAGGACTTCTTGGCCTGGAAGGATCCCATGTGGGCTGCTCTGGCCAGCAAGTTGGGT
CTGGAGGAGCGCGAGGCCATCTACGAGCCAACGTTTGAGCTCATCTACCGTTCCGAGCTGACGCCCGAAAGCAGC
CAGGTCTATCTGGGCGAGCTTAACAAGATGCACCTCGAGGGCTCGGCCAAGGGTCCCTTCAACGCGCATAACCCC
TACATCGCCCCCATCGTCGCCTCCCGCGAGCTCTTCTCAGCAAAGGACCGCAACTGCATCCATATGGACATCGAC
GTCAGCAGTTCCAACTTGACGTATCAGACTGGCGACCACATCGCCGTCTGGCCGACCAACCCAGGTGACGAGGTC
GACCGCTTTCTCGACGTCGTCGGCCTTGGCGACTCGCGGCACAAGGTCGTCAGCGTCAAGGCGCTGGAGCCGACG
GCCAAGGTTCCTTTCCCCACGCCTACGACGTTCGACGCCATCGTCCGCTACCACCTCGAGATCTGCGCGCCCGTC
TCGCGCCAGTTCCTCTTCACGCTCGCCCCTTTCTCTCCCAACGACGATATCCGGATCGAGATGACGAGACTCGGC
AGCGACAAGGATTACTTCCATCAGAAGACGGGACCCAACTACTACAACATCGCCCGCCTCCTGGCCGCTGTCGGT
AAGGGCGAGCGCTGGACCAAGATCCCCTTCTCGGCCTTCATCGAGGGCCTCAACAAGCTTCAGCCGCGGTACTAC
TCCATCTCGTCCTCGTCACTCGTCTCGCCCAAGGTCATCTCCATCACGGCCGTCGTCGAGTCGCAAGCGATTCCC
GGCCGCGACGGACCTTTCCGCGGCGTCGCGACAAACTACCTACTCGCGCTCAAGCAGCGCCAGAACGGAGACCCG
AACCCGGAACCATTCGGGCAGTCGTACGAGATCAACGGCCCGCGCAACCGGTACGACGGCATTCACGTGCCCGTT
CACGTGCGCCACTCCAACTTCAAGCTACCCTCGGACCCGAGCAAGCCCATCATCATGATCGGTCCGGGCACCGGC
GTCGCCCCCTTCCGCGGCTTCGTCCAGGAACGCGCCAAGCAAGCCCAGAACGGCGTTCCCGTCGGCCGAACCCTG
CTCTTCTTTGGCTGCCGAAAGCGTGCCGAGGATTTCATGTATGAGCAGGAGTGGGAGGAATGTAAAAAGATGCTC
GGCGACAACTTTGAGATGATCACGGCCTTTTCTCGCGACGGCAACAAGAAGGTCTACGTCCAACATCGTCTCAAG
GAACGCGCCCGTGACGTCAACGACCTCCTTTCCCAAAAGGCTTACTTCTACGTCTGCGGCGACGCGGCGAACATG
GCGCGCGAGGTCAACACCGTCCTGGCTCAGATCATTGCCGAGGCCCGCGGCGTATCGGAGCAAAAGGGCGAGGAG
GTTGTCAAGCACATGAGGGCCGCGAATCAATATCAGGAAGACGTCTGGTCATGA
Gene >Ophcf2|02790
ATGGCTGCCCTCGACACGCTCGATGTCGTCGTCCTCGTCGCTCTTCTCGTCGGCACCGTCGCCTACTTCACAAAG
GGTACCTACTGGGGCGTCGTCAAGGACCCCTACGCCAATGCCTTTGCCAACGCCAATGGCTCCGTTCCGGGCCGC
ACCCGCAACATCGTCGAAAAGATGGAGGAGTCTGGCAAGAACTGCGTCGTATTCTACGGCTCGCAGACCGGAACC
GCCGAGGACTACGCCTCACGACTCGCAAAGGAGGGCAAAAGCCGCTTTGGTCTCGAGACAATGGTCGCCGACCTC
GAAGAGTATGACTTTGACAACCTAGACACTTTCCCGTCCGACAAGGTCTGCATGTTCGTCCTGGCTACATACGGC
GAAGGCGAGCCGACAGACAACGCCGTCGACTTTTACGAATTCATCTCGGCCGAAGACGTGTCTCTGTCGGAGAGC
AACGACCCGCCTCTTGGTAACCTCAACTACGTCGCATTCGGACTCGGCAACAATACGTACGAGCACTACAACTCC
ATGGTCCGCAACGTCGACAAGGCCCTTGCGAAGCTCGGCGCCCACCGAGTCGGCGATGCCGGTGAGGGCGACGAC
GGTGCCGGCACAATGGAGGAGGACTTCTTGGCCTGGAAGGATCCCATGTGGGCTGCTCTGGCCAGCAAGTTGGGT
CTGGAGGAGCGCGAGGCCATCTACGAGCCAACGTTTGAGCTCATCTACCGTTCCGAGCTGACGCCCGAAAGCAGC
CAGGTCTATCTGGGCGAGCTTAACAAGATGCACCTCGAGGGCTCGGCCAAGGGTCCCTTCAACGCGCATAACCCC
TACATCGCCCCCATCGTCGCCTCCCGCGAGCTCTTCTCAGCAAAGGACCGCAACTGCATCCATATGGACATCGAC
GTCAGCAGTTCCAACTTGACGTATCAGACTGGCGACCACATCGCCGTCTGGCCGACCAACCCAGGTGACGAGGTC
GACCGCTTTCTCGACGTCGTCGGCCTTGGCGACTCGCGGCACAAGGTCGTCAGCGTCAAGGCGCTGGAGCCGACG
GCCAAGGTTCCTTTCCCCACGCCTACGACGTTCGACGCCATCGTCCGCTACCACCTCGAGATCTGCGCGCCCGTC
TCGCGCCAGTTCCTCTTCACGCTCGCCCCTTTCTCTCCCAACGACGATATCCGGATCGAGATGACGAGACTCGGC
AGCGACAAGGATTACTTCCATCAGAAGACGGGACCCAACTACTACAACATCGCCCGCCTCCTGGCCGCTGTCGGT
AAGGGCGAGCGCTGGACCAAGATCCCCTTCTCGGCCTTCATCGAGGGCCTCAACAAGCTTCAGCCGCGGTACTAC
TCCATCTCGTCCTCGTCACTCGTCTCGCCCAAGGTCATCTCCATCACGGCCGTCGTCGAGTCGCAAGCGATTCCC
GGCCGCGACGGACCTTTCCGCGGCGTCGCGACAAACTACCTACTCGCGCTCAAGCAGCGCCAGAACGGAGACCCG
AACCCGGAACCATTCGGGCAGTCGTACGAGATCAACGGCCCGCGCAACCGGTACGACGGCATTCACGTGCCCGTT
CACGTGCGCCACTCCAACTTCAAGCTACCCTCGGACCCGAGCAAGCCCATCATCATGATCGGTCCGGGCACCGGC
GTCGCCCCCTTCCGCGGCTTCGTCCAGGAACGCGCCAAGCAAGCCCAGAACGGCGTTCCCGTCGGCCGAACCCTG
CTCTTCTTTGGCTGCCGAAAGCGTGCCGAGGATTTCATGTATGAGCAGGAGTGGGAGGTATGTGATCTCCCACCC
CGGTCCACCGCCTCCTTTTACATACGGATTCCCTTGTTCCCTGACGTTCCCCGCTGCAGGAATGTAAAAAGATGC
TCGGCGACAACTTTGAGATGATCACGGCCTTTTCTCGCGACGGCAACAAGAAGGTCTACGTCCAACATCGTCTCA
AGGAACGCGCCCGTGACGTCAACGACCTCCTTTCCCAAAAGGCTTACTTCTACGTCTGCGGCGACGCGGCGAACA
TGGCGCGCGAGGTCAACACCGTCCTGGCTCAGATCATTGCCGAGGCCCGCGGCGTATCGGAGCAAAAGGGCGAGG
AGGTTGTCAAGCACATGAGGGCCGCGAATCAATATCAGGTGCGTCTTCACGTCCTCTTGTCTTCTTTTCTTTTCC
CAGTTTCTTCCTATAGCAACACTTACTTACGACCTCTACCATCTTCTCTCTTCCTCCCCGACTACAGGAAGACGT
CTGGTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail