Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02790
Gene name
Locationscaffold_02:4773446..4775706
Strand+
Gene length (bp)2260
Transcript length (bp)2079
Coding sequence length (bp)2079
Protein length (aa) 693

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00667 FAD_binding_1 FAD binding domain 2.4E-60 269 488
PF00258 Flavodoxin_1 Flavodoxin 5.0E-34 67 212
PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain 4.5E-19 544 654

GO

GO Term Description Terminal node
GO:0010181 FMN binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:1901265 nucleoside phosphate binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02790
MAALDTLDVVVLVALLVGTVAYFTKGTYWGVVKDPYANAFANANGSVPGRTRNIVEKMEESGKNCVVFYGSQTGT
AEDYASRLAKEGKSRFGLETMVADLEEYDFDNLDTFPSDKVCMFVLATYGEGEPTDNAVDFYEFISAEDVSLSES
NDPPLGNLNYVAFGLGNNTYEHYNSMVRNVDKALAKLGAHRVGDAGEGDDGAGTMEEDFLAWKDPMWAALASKLG
LEEREAIYEPTFELIYRSELTPESSQVYLGELNKMHLEGSAKGPFNAHNPYIAPIVASRELFSAKDRNCIHMDID
VSSSNLTYQTGDHIAVWPTNPGDEVDRFLDVVGLGDSRHKVVSVKALEPTAKVPFPTPTTFDAIVRYHLEICAPV
SRQFLFTLAPFSPNDDIRIEMTRLGSDKDYFHQKTGPNYYNIARLLAAVGKGERWTKIPFSAFIEGLNKLQPRYY
SISSSSLVSPKVISITAVVESQAIPGRDGPFRGVATNYLLALKQRQNGDPNPEPFGQSYEINGPRNRYDGIHVPV
HVRHSNFKLPSDPSKPIIMIGPGTGVAPFRGFVQERAKQAQNGVPVGRTLLFFGCRKRAEDFMYEQEWEECKKML
GDNFEMITAFSRDGNKKVYVQHRLKERARDVNDLLSQKAYFYVCGDAANMAREVNTVLAQIIAEARGVSEQKGEE
VVKHMRAANQYQEDVWS*
Coding >Ophcf2|02790
ATGGCTGCCCTCGACACGCTCGATGTCGTCGTCCTCGTCGCTCTTCTCGTCGGCACCGTCGCCTACTTCACAAAG
GGTACCTACTGGGGCGTCGTCAAGGACCCCTACGCCAATGCCTTTGCCAACGCCAATGGCTCCGTTCCGGGCCGC
ACCCGCAACATCGTCGAAAAGATGGAGGAGTCTGGCAAGAACTGCGTCGTATTCTACGGCTCGCAGACCGGAACC
GCCGAGGACTACGCCTCACGACTCGCAAAGGAGGGCAAAAGCCGCTTTGGTCTCGAGACAATGGTCGCCGACCTC
GAAGAGTATGACTTTGACAACCTAGACACTTTCCCGTCCGACAAGGTCTGCATGTTCGTCCTGGCTACATACGGC
GAAGGCGAGCCGACAGACAACGCCGTCGACTTTTACGAATTCATCTCGGCCGAAGACGTGTCTCTGTCGGAGAGC
AACGACCCGCCTCTTGGTAACCTCAACTACGTCGCATTCGGACTCGGCAACAATACGTACGAGCACTACAACTCC
ATGGTCCGCAACGTCGACAAGGCCCTTGCGAAGCTCGGCGCCCACCGAGTCGGCGATGCCGGTGAGGGCGACGAC
GGTGCCGGCACAATGGAGGAGGACTTCTTGGCCTGGAAGGATCCCATGTGGGCTGCTCTGGCCAGCAAGTTGGGT
CTGGAGGAGCGCGAGGCCATCTACGAGCCAACGTTTGAGCTCATCTACCGTTCCGAGCTGACGCCCGAAAGCAGC
CAGGTCTATCTGGGCGAGCTTAACAAGATGCACCTCGAGGGCTCGGCCAAGGGTCCCTTCAACGCGCATAACCCC
TACATCGCCCCCATCGTCGCCTCCCGCGAGCTCTTCTCAGCAAAGGACCGCAACTGCATCCATATGGACATCGAC
GTCAGCAGTTCCAACTTGACGTATCAGACTGGCGACCACATCGCCGTCTGGCCGACCAACCCAGGTGACGAGGTC
GACCGCTTTCTCGACGTCGTCGGCCTTGGCGACTCGCGGCACAAGGTCGTCAGCGTCAAGGCGCTGGAGCCGACG
GCCAAGGTTCCTTTCCCCACGCCTACGACGTTCGACGCCATCGTCCGCTACCACCTCGAGATCTGCGCGCCCGTC
TCGCGCCAGTTCCTCTTCACGCTCGCCCCTTTCTCTCCCAACGACGATATCCGGATCGAGATGACGAGACTCGGC
AGCGACAAGGATTACTTCCATCAGAAGACGGGACCCAACTACTACAACATCGCCCGCCTCCTGGCCGCTGTCGGT
AAGGGCGAGCGCTGGACCAAGATCCCCTTCTCGGCCTTCATCGAGGGCCTCAACAAGCTTCAGCCGCGGTACTAC
TCCATCTCGTCCTCGTCACTCGTCTCGCCCAAGGTCATCTCCATCACGGCCGTCGTCGAGTCGCAAGCGATTCCC
GGCCGCGACGGACCTTTCCGCGGCGTCGCGACAAACTACCTACTCGCGCTCAAGCAGCGCCAGAACGGAGACCCG
AACCCGGAACCATTCGGGCAGTCGTACGAGATCAACGGCCCGCGCAACCGGTACGACGGCATTCACGTGCCCGTT
CACGTGCGCCACTCCAACTTCAAGCTACCCTCGGACCCGAGCAAGCCCATCATCATGATCGGTCCGGGCACCGGC
GTCGCCCCCTTCCGCGGCTTCGTCCAGGAACGCGCCAAGCAAGCCCAGAACGGCGTTCCCGTCGGCCGAACCCTG
CTCTTCTTTGGCTGCCGAAAGCGTGCCGAGGATTTCATGTATGAGCAGGAGTGGGAGGAATGTAAAAAGATGCTC
GGCGACAACTTTGAGATGATCACGGCCTTTTCTCGCGACGGCAACAAGAAGGTCTACGTCCAACATCGTCTCAAG
GAACGCGCCCGTGACGTCAACGACCTCCTTTCCCAAAAGGCTTACTTCTACGTCTGCGGCGACGCGGCGAACATG
GCGCGCGAGGTCAACACCGTCCTGGCTCAGATCATTGCCGAGGCCCGCGGCGTATCGGAGCAAAAGGGCGAGGAG
GTTGTCAAGCACATGAGGGCCGCGAATCAATATCAGGAAGACGTCTGGTCATGA
Transcript >Ophcf2|02790
ATGGCTGCCCTCGACACGCTCGATGTCGTCGTCCTCGTCGCTCTTCTCGTCGGCACCGTCGCCTACTTCACAAAG
GGTACCTACTGGGGCGTCGTCAAGGACCCCTACGCCAATGCCTTTGCCAACGCCAATGGCTCCGTTCCGGGCCGC
ACCCGCAACATCGTCGAAAAGATGGAGGAGTCTGGCAAGAACTGCGTCGTATTCTACGGCTCGCAGACCGGAACC
GCCGAGGACTACGCCTCACGACTCGCAAAGGAGGGCAAAAGCCGCTTTGGTCTCGAGACAATGGTCGCCGACCTC
GAAGAGTATGACTTTGACAACCTAGACACTTTCCCGTCCGACAAGGTCTGCATGTTCGTCCTGGCTACATACGGC
GAAGGCGAGCCGACAGACAACGCCGTCGACTTTTACGAATTCATCTCGGCCGAAGACGTGTCTCTGTCGGAGAGC
AACGACCCGCCTCTTGGTAACCTCAACTACGTCGCATTCGGACTCGGCAACAATACGTACGAGCACTACAACTCC
ATGGTCCGCAACGTCGACAAGGCCCTTGCGAAGCTCGGCGCCCACCGAGTCGGCGATGCCGGTGAGGGCGACGAC
GGTGCCGGCACAATGGAGGAGGACTTCTTGGCCTGGAAGGATCCCATGTGGGCTGCTCTGGCCAGCAAGTTGGGT
CTGGAGGAGCGCGAGGCCATCTACGAGCCAACGTTTGAGCTCATCTACCGTTCCGAGCTGACGCCCGAAAGCAGC
CAGGTCTATCTGGGCGAGCTTAACAAGATGCACCTCGAGGGCTCGGCCAAGGGTCCCTTCAACGCGCATAACCCC
TACATCGCCCCCATCGTCGCCTCCCGCGAGCTCTTCTCAGCAAAGGACCGCAACTGCATCCATATGGACATCGAC
GTCAGCAGTTCCAACTTGACGTATCAGACTGGCGACCACATCGCCGTCTGGCCGACCAACCCAGGTGACGAGGTC
GACCGCTTTCTCGACGTCGTCGGCCTTGGCGACTCGCGGCACAAGGTCGTCAGCGTCAAGGCGCTGGAGCCGACG
GCCAAGGTTCCTTTCCCCACGCCTACGACGTTCGACGCCATCGTCCGCTACCACCTCGAGATCTGCGCGCCCGTC
TCGCGCCAGTTCCTCTTCACGCTCGCCCCTTTCTCTCCCAACGACGATATCCGGATCGAGATGACGAGACTCGGC
AGCGACAAGGATTACTTCCATCAGAAGACGGGACCCAACTACTACAACATCGCCCGCCTCCTGGCCGCTGTCGGT
AAGGGCGAGCGCTGGACCAAGATCCCCTTCTCGGCCTTCATCGAGGGCCTCAACAAGCTTCAGCCGCGGTACTAC
TCCATCTCGTCCTCGTCACTCGTCTCGCCCAAGGTCATCTCCATCACGGCCGTCGTCGAGTCGCAAGCGATTCCC
GGCCGCGACGGACCTTTCCGCGGCGTCGCGACAAACTACCTACTCGCGCTCAAGCAGCGCCAGAACGGAGACCCG
AACCCGGAACCATTCGGGCAGTCGTACGAGATCAACGGCCCGCGCAACCGGTACGACGGCATTCACGTGCCCGTT
CACGTGCGCCACTCCAACTTCAAGCTACCCTCGGACCCGAGCAAGCCCATCATCATGATCGGTCCGGGCACCGGC
GTCGCCCCCTTCCGCGGCTTCGTCCAGGAACGCGCCAAGCAAGCCCAGAACGGCGTTCCCGTCGGCCGAACCCTG
CTCTTCTTTGGCTGCCGAAAGCGTGCCGAGGATTTCATGTATGAGCAGGAGTGGGAGGAATGTAAAAAGATGCTC
GGCGACAACTTTGAGATGATCACGGCCTTTTCTCGCGACGGCAACAAGAAGGTCTACGTCCAACATCGTCTCAAG
GAACGCGCCCGTGACGTCAACGACCTCCTTTCCCAAAAGGCTTACTTCTACGTCTGCGGCGACGCGGCGAACATG
GCGCGCGAGGTCAACACCGTCCTGGCTCAGATCATTGCCGAGGCCCGCGGCGTATCGGAGCAAAAGGGCGAGGAG
GTTGTCAAGCACATGAGGGCCGCGAATCAATATCAGGAAGACGTCTGGTCATGA
Gene >Ophcf2|02790
ATGGCTGCCCTCGACACGCTCGATGTCGTCGTCCTCGTCGCTCTTCTCGTCGGCACCGTCGCCTACTTCACAAAG
GGTACCTACTGGGGCGTCGTCAAGGACCCCTACGCCAATGCCTTTGCCAACGCCAATGGCTCCGTTCCGGGCCGC
ACCCGCAACATCGTCGAAAAGATGGAGGAGTCTGGCAAGAACTGCGTCGTATTCTACGGCTCGCAGACCGGAACC
GCCGAGGACTACGCCTCACGACTCGCAAAGGAGGGCAAAAGCCGCTTTGGTCTCGAGACAATGGTCGCCGACCTC
GAAGAGTATGACTTTGACAACCTAGACACTTTCCCGTCCGACAAGGTCTGCATGTTCGTCCTGGCTACATACGGC
GAAGGCGAGCCGACAGACAACGCCGTCGACTTTTACGAATTCATCTCGGCCGAAGACGTGTCTCTGTCGGAGAGC
AACGACCCGCCTCTTGGTAACCTCAACTACGTCGCATTCGGACTCGGCAACAATACGTACGAGCACTACAACTCC
ATGGTCCGCAACGTCGACAAGGCCCTTGCGAAGCTCGGCGCCCACCGAGTCGGCGATGCCGGTGAGGGCGACGAC
GGTGCCGGCACAATGGAGGAGGACTTCTTGGCCTGGAAGGATCCCATGTGGGCTGCTCTGGCCAGCAAGTTGGGT
CTGGAGGAGCGCGAGGCCATCTACGAGCCAACGTTTGAGCTCATCTACCGTTCCGAGCTGACGCCCGAAAGCAGC
CAGGTCTATCTGGGCGAGCTTAACAAGATGCACCTCGAGGGCTCGGCCAAGGGTCCCTTCAACGCGCATAACCCC
TACATCGCCCCCATCGTCGCCTCCCGCGAGCTCTTCTCAGCAAAGGACCGCAACTGCATCCATATGGACATCGAC
GTCAGCAGTTCCAACTTGACGTATCAGACTGGCGACCACATCGCCGTCTGGCCGACCAACCCAGGTGACGAGGTC
GACCGCTTTCTCGACGTCGTCGGCCTTGGCGACTCGCGGCACAAGGTCGTCAGCGTCAAGGCGCTGGAGCCGACG
GCCAAGGTTCCTTTCCCCACGCCTACGACGTTCGACGCCATCGTCCGCTACCACCTCGAGATCTGCGCGCCCGTC
TCGCGCCAGTTCCTCTTCACGCTCGCCCCTTTCTCTCCCAACGACGATATCCGGATCGAGATGACGAGACTCGGC
AGCGACAAGGATTACTTCCATCAGAAGACGGGACCCAACTACTACAACATCGCCCGCCTCCTGGCCGCTGTCGGT
AAGGGCGAGCGCTGGACCAAGATCCCCTTCTCGGCCTTCATCGAGGGCCTCAACAAGCTTCAGCCGCGGTACTAC
TCCATCTCGTCCTCGTCACTCGTCTCGCCCAAGGTCATCTCCATCACGGCCGTCGTCGAGTCGCAAGCGATTCCC
GGCCGCGACGGACCTTTCCGCGGCGTCGCGACAAACTACCTACTCGCGCTCAAGCAGCGCCAGAACGGAGACCCG
AACCCGGAACCATTCGGGCAGTCGTACGAGATCAACGGCCCGCGCAACCGGTACGACGGCATTCACGTGCCCGTT
CACGTGCGCCACTCCAACTTCAAGCTACCCTCGGACCCGAGCAAGCCCATCATCATGATCGGTCCGGGCACCGGC
GTCGCCCCCTTCCGCGGCTTCGTCCAGGAACGCGCCAAGCAAGCCCAGAACGGCGTTCCCGTCGGCCGAACCCTG
CTCTTCTTTGGCTGCCGAAAGCGTGCCGAGGATTTCATGTATGAGCAGGAGTGGGAGGTATGTGATCTCCCACCC
CGGTCCACCGCCTCCTTTTACATACGGATTCCCTTGTTCCCTGACGTTCCCCGCTGCAGGAATGTAAAAAGATGC
TCGGCGACAACTTTGAGATGATCACGGCCTTTTCTCGCGACGGCAACAAGAAGGTCTACGTCCAACATCGTCTCA
AGGAACGCGCCCGTGACGTCAACGACCTCCTTTCCCAAAAGGCTTACTTCTACGTCTGCGGCGACGCGGCGAACA
TGGCGCGCGAGGTCAACACCGTCCTGGCTCAGATCATTGCCGAGGCCCGCGGCGTATCGGAGCAAAAGGGCGAGG
AGGTTGTCAAGCACATGAGGGCCGCGAATCAATATCAGGTGCGTCTTCACGTCCTCTTGTCTTCTTTTCTTTTCC
CAGTTTCTTCCTATAGCAACACTTACTTACGACCTCTACCATCTTCTCTCTTCCTCCCCGACTACAGGAAGACGT
CTGGTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail