Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02787
Gene name
Locationscaffold_02:4761988..4762738
Strand-
Gene length (bp)750
Transcript length (bp)750
Coding sequence length (bp)750
Protein length (aa) 250

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10356 DUF2034 Protein of unknown function (DUF2034) 8.2E-13 68 113
PF10356 DUF2034 Protein of unknown function (DUF2034) 4.2E-13 115 206
PF04471 Mrr_cat Restriction endonuclease 1.2E-07 75 142

GO

GO Term Description Terminal node
GO:0004519 endonuclease activity Yes
GO:0009307 DNA restriction-modification system Yes
GO:0003677 DNA binding Yes
GO:0099046 clearance of foreign intracellular nucleic acids No
GO:1901360 organic cyclic compound metabolic process No
GO:0003824 catalytic activity No
GO:0009605 response to external stimulus No
GO:0006304 DNA modification No
GO:0043170 macromolecule metabolic process No
GO:0006259 DNA metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0005488 binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0009607 response to biotic stimulus No
GO:0003676 nucleic acid binding No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0071704 organic substance metabolic process No
GO:0051707 response to other organism No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0004518 nuclease activity No
GO:0008150 biological_process No
GO:0006950 response to stress No
GO:0043412 macromolecule modification No
GO:0043207 response to external biotic stimulus No
GO:0090304 nucleic acid metabolic process No
GO:0050896 response to stimulus No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0044355 clearance of foreign intracellular DNA No
GO:0044419 biological process involved in interspecies interaction between organisms No
GO:0006807 nitrogen compound metabolic process No
GO:0006952 defense response No
GO:0044238 primary metabolic process No
GO:0098542 defense response to other organism No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1565 0.2199 0.0474 0.0662 0.9681 0.0329 0.0308 0.0428 0.0357 0.0278

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 85.82 47.14 124.50
Alive In ants, during behavior modification 50.57 25.12 76.02
Dead In ants, recently dead 60.18 31.21 89.16

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.007897 yes
Alive Dead 0.387965 no
Dead Fungus 0.083004 no

Orthologs

Orthofinder run ID4
Orthogroup6335
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1516
Ophiocordyceps australis map64 (Brazil) OphauB2|1193
Ophiocordyceps camponoti-floridani Ophcf2|02787 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5698
Ophiocordyceps kimflemingae Ophio5|5278

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02787
MLAARRLRLLWKRNSVQKALRIQIFQQRLIHSQSADESDALPEPSSAQHSDLTSFLDYARRSGLNSRSTVYVGTH
YEYTVAAALSRHGFSLQRVGGASDYGTDLVGTWTLPPFPRPMRVLLQCKAGVQRVGPHHVRELEGAFIGAPVGWR
GHGVLGVLVCERPATRGIRDSLIRSRWPMAFLCCSKEGGLSQLLWNRRAEDEGLQGLGVAVRYAEESSTAPELVF
TCNGLAVGRSNDHFEASVLSLEGV*
Coding >Ophcf2|02787
ATGCTGGCAGCCAGGCGGCTGAGGCTGCTGTGGAAGCGCAATTCAGTGCAGAAGGCGCTGAGAATACAGATCTTT
CAGCAGCGTCTCATTCACAGCCAGTCAGCAGACGAATCCGACGCCCTCCCCGAACCGTCATCGGCGCAGCATTCG
GACCTCACGAGCTTCCTCGACTACGCGCGTCGCAGCGGCCTCAACTCGCGCTCAACCGTCTACGTCGGCACTCAC
TACGAATACACCGTCGCAGCCGCCCTTTCCAGGCACGGCTTCTCTCTGCAGCGCGTCGGCGGCGCTTCCGACTAC
GGCACCGACCTGGTCGGGACGTGGACCCTTCCGCCCTTCCCGCGGCCCATGAGGGTACTGCTCCAGTGCAAGGCC
GGCGTCCAGCGCGTCGGGCCTCATCACGTGAGGGAGCTCGAGGGCGCTTTCATCGGGGCCCCGGTTGGCTGGAGG
GGCCATGGCGTGCTGGGCGTCTTGGTGTGCGAGAGGCCGGCTACGAGGGGTATTCGGGATTCGCTGATTCGCAGC
CGCTGGCCCATGGCTTTCTTGTGCTGCTCCAAGGAAGGCGGTTTGAGTCAGCTGTTGTGGAATAGGCGGGCTGAA
GACGAGGGGCTTCAGGGCTTGGGCGTTGCGGTTCGGTATGCCGAGGAGTCGTCGACTGCTCCGGAACTGGTCTTT
ACCTGCAACGGCCTGGCAGTGGGACGGAGTAATGATCATTTTGAGGCGTCGGTTCTTTCGCTGGAGGGTGTTTAG
Transcript >Ophcf2|02787
ATGCTGGCAGCCAGGCGGCTGAGGCTGCTGTGGAAGCGCAATTCAGTGCAGAAGGCGCTGAGAATACAGATCTTT
CAGCAGCGTCTCATTCACAGCCAGTCAGCAGACGAATCCGACGCCCTCCCCGAACCGTCATCGGCGCAGCATTCG
GACCTCACGAGCTTCCTCGACTACGCGCGTCGCAGCGGCCTCAACTCGCGCTCAACCGTCTACGTCGGCACTCAC
TACGAATACACCGTCGCAGCCGCCCTTTCCAGGCACGGCTTCTCTCTGCAGCGCGTCGGCGGCGCTTCCGACTAC
GGCACCGACCTGGTCGGGACGTGGACCCTTCCGCCCTTCCCGCGGCCCATGAGGGTACTGCTCCAGTGCAAGGCC
GGCGTCCAGCGCGTCGGGCCTCATCACGTGAGGGAGCTCGAGGGCGCTTTCATCGGGGCCCCGGTTGGCTGGAGG
GGCCATGGCGTGCTGGGCGTCTTGGTGTGCGAGAGGCCGGCTACGAGGGGTATTCGGGATTCGCTGATTCGCAGC
CGCTGGCCCATGGCTTTCTTGTGCTGCTCCAAGGAAGGCGGTTTGAGTCAGCTGTTGTGGAATAGGCGGGCTGAA
GACGAGGGGCTTCAGGGCTTGGGCGTTGCGGTTCGGTATGCCGAGGAGTCGTCGACTGCTCCGGAACTGGTCTTT
ACCTGCAACGGCCTGGCAGTGGGACGGAGTAATGATCATTTTGAGGCGTCGGTTCTTTCGCTGGAGGGTGTTTAG
Gene >Ophcf2|02787
ATGCTGGCAGCCAGGCGGCTGAGGCTGCTGTGGAAGCGCAATTCAGTGCAGAAGGCGCTGAGAATACAGATCTTT
CAGCAGCGTCTCATTCACAGCCAGTCAGCAGACGAATCCGACGCCCTCCCCGAACCGTCATCGGCGCAGCATTCG
GACCTCACGAGCTTCCTCGACTACGCGCGTCGCAGCGGCCTCAACTCGCGCTCAACCGTCTACGTCGGCACTCAC
TACGAATACACCGTCGCAGCCGCCCTTTCCAGGCACGGCTTCTCTCTGCAGCGCGTCGGCGGCGCTTCCGACTAC
GGCACCGACCTGGTCGGGACGTGGACCCTTCCGCCCTTCCCGCGGCCCATGAGGGTACTGCTCCAGTGCAAGGCC
GGCGTCCAGCGCGTCGGGCCTCATCACGTGAGGGAGCTCGAGGGCGCTTTCATCGGGGCCCCGGTTGGCTGGAGG
GGCCATGGCGTGCTGGGCGTCTTGGTGTGCGAGAGGCCGGCTACGAGGGGTATTCGGGATTCGCTGATTCGCAGC
CGCTGGCCCATGGCTTTCTTGTGCTGCTCCAAGGAAGGCGGTTTGAGTCAGCTGTTGTGGAATAGGCGGGCTGAA
GACGAGGGGCTTCAGGGCTTGGGCGTTGCGGTTCGGTATGCCGAGGAGTCGTCGACTGCTCCGGAACTGGTCTTT
ACCTGCAACGGCCTGGCAGTGGGACGGAGTAATGATCATTTTGAGGCGTCGGTTCTTTCGCTGGAGGGTGTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail