Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02782
Gene name
Locationscaffold_02:4748332..4749463
Strand-
Gene length (bp)1131
Transcript length (bp)1131
Coding sequence length (bp)1131
Protein length (aa) 377

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20246 DUF6601 Family of unknown function (DUF6601) 1.2E-72 95 332

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 286 308 22
2 328 350 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.37 0.0 0.85
Alive In ants, during behavior modification 1.14 0.0 2.60
Dead In ants, recently dead 0.76 0.0 1.64

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.049023 yes
Alive Dead 0.382300 no
Dead Fungus 0.211543 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02782
MSPPLPRWQADSGASNSRPFYAEPPFNRDVAPVVNGRFRYDSSDCSEGSMTSGASQFCSPPLDAINFSSYKDLTP
TLYLAGGQKGARAYRIDSIEEYLAASFDLERLHLIQNRLWLAGLPVPARSLHRQKILGREIVITDQSDLHLTWRE
STLFLKPLWEPLLDHGFWRYELCNKDVKTYLSATGLLMSYIWLICSEPDLLIAKQHNLVPRKLNWAAWAFFSRDF
LDRHSLDGHNEDMAKRYDYGELRIQRLNLIYRFAPETFPNYLLRGYLYGYNQFSQFFGRNFAWAAVAVLYAGVVL
AAMQVALAVPPIKDDVSFQRAAYGFTVFILVAMVFFSTFALAYLVIVFNLNLIFTRQKVRQHEQRAKEATRSNNA
P*
Coding >Ophcf2|02782
ATGTCACCTCCCCTTCCGAGATGGCAGGCCGACTCGGGAGCCAGCAATTCGAGACCGTTTTACGCCGAGCCCCCC
TTCAACAGAGACGTGGCGCCCGTCGTCAACGGAAGATTTCGATATGATTCCAGTGATTGCAGTGAAGGCTCGATG
ACCTCTGGTGCGAGCCAATTCTGCTCGCCGCCTTTGGATGCCATTAATTTCTCGTCTTACAAGGACTTGACGCCG
ACTCTCTACCTTGCAGGCGGTCAAAAGGGAGCAAGAGCCTATCGCATCGACTCCATCGAGGAATATCTCGCTGCC
TCTTTCGACCTGGAACGGCTCCATCTCATTCAAAACCGTCTATGGCTGGCCGGACTCCCCGTTCCCGCACGGTCG
TTGCATAGACAAAAGATACTCGGTCGCGAGATTGTCATCACGGATCAGTCAGACCTGCATCTCACCTGGCGTGAG
TCGACTCTCTTCCTCAAGCCCTTGTGGGAACCCCTTCTCGATCATGGTTTCTGGCGATATGAGCTCTGCAACAAA
GACGTCAAGACTTATCTCAGTGCCACTGGTCTTCTCATGTCTTACATCTGGCTCATCTGCTCCGAGCCAGACCTG
CTGATCGCAAAACAACACAACTTGGTGCCCCGTAAGCTCAACTGGGCAGCTTGGGCCTTCTTCTCCCGGGACTTC
CTCGACAGGCATTCTCTAGACGGACACAACGAGGACATGGCCAAACGATACGACTACGGCGAGTTACGAATCCAA
CGCCTCAACTTGATCTATCGGTTCGCGCCCGAGACGTTCCCAAACTATCTCCTCCGCGGCTATCTCTACGGCTAC
AACCAGTTCAGCCAGTTCTTCGGCCGTAACTTTGCCTGGGCGGCCGTGGCGGTGCTGTATGCTGGTGTCGTGCTG
GCGGCTATGCAGGTGGCGCTCGCCGTGCCTCCTATCAAGGACGACGTGAGTTTCCAGAGGGCGGCTTATGGATTT
ACCGTCTTCATTCTGGTTGCCATGGTCTTCTTCTCTACTTTCGCGCTGGCGTATCTTGTCATCGTGTTTAATTTG
AACCTCATCTTCACCAGACAGAAAGTCAGGCAACATGAGCAACGGGCAAAGGAAGCGACGAGGTCGAACAACGCC
CCATAG
Transcript >Ophcf2|02782
ATGTCACCTCCCCTTCCGAGATGGCAGGCCGACTCGGGAGCCAGCAATTCGAGACCGTTTTACGCCGAGCCCCCC
TTCAACAGAGACGTGGCGCCCGTCGTCAACGGAAGATTTCGATATGATTCCAGTGATTGCAGTGAAGGCTCGATG
ACCTCTGGTGCGAGCCAATTCTGCTCGCCGCCTTTGGATGCCATTAATTTCTCGTCTTACAAGGACTTGACGCCG
ACTCTCTACCTTGCAGGCGGTCAAAAGGGAGCAAGAGCCTATCGCATCGACTCCATCGAGGAATATCTCGCTGCC
TCTTTCGACCTGGAACGGCTCCATCTCATTCAAAACCGTCTATGGCTGGCCGGACTCCCCGTTCCCGCACGGTCG
TTGCATAGACAAAAGATACTCGGTCGCGAGATTGTCATCACGGATCAGTCAGACCTGCATCTCACCTGGCGTGAG
TCGACTCTCTTCCTCAAGCCCTTGTGGGAACCCCTTCTCGATCATGGTTTCTGGCGATATGAGCTCTGCAACAAA
GACGTCAAGACTTATCTCAGTGCCACTGGTCTTCTCATGTCTTACATCTGGCTCATCTGCTCCGAGCCAGACCTG
CTGATCGCAAAACAACACAACTTGGTGCCCCGTAAGCTCAACTGGGCAGCTTGGGCCTTCTTCTCCCGGGACTTC
CTCGACAGGCATTCTCTAGACGGACACAACGAGGACATGGCCAAACGATACGACTACGGCGAGTTACGAATCCAA
CGCCTCAACTTGATCTATCGGTTCGCGCCCGAGACGTTCCCAAACTATCTCCTCCGCGGCTATCTCTACGGCTAC
AACCAGTTCAGCCAGTTCTTCGGCCGTAACTTTGCCTGGGCGGCCGTGGCGGTGCTGTATGCTGGTGTCGTGCTG
GCGGCTATGCAGGTGGCGCTCGCCGTGCCTCCTATCAAGGACGACGTGAGTTTCCAGAGGGCGGCTTATGGATTT
ACCGTCTTCATTCTGGTTGCCATGGTCTTCTTCTCTACTTTCGCGCTGGCGTATCTTGTCATCGTGTTTAATTTG
AACCTCATCTTCACCAGACAGAAAGTCAGGCAACATGAGCAACGGGCAAAGGAAGCGACGAGGTCGAACAACGCC
CCATAG
Gene >Ophcf2|02782
ATGTCACCTCCCCTTCCGAGATGGCAGGCCGACTCGGGAGCCAGCAATTCGAGACCGTTTTACGCCGAGCCCCCC
TTCAACAGAGACGTGGCGCCCGTCGTCAACGGAAGATTTCGATATGATTCCAGTGATTGCAGTGAAGGCTCGATG
ACCTCTGGTGCGAGCCAATTCTGCTCGCCGCCTTTGGATGCCATTAATTTCTCGTCTTACAAGGACTTGACGCCG
ACTCTCTACCTTGCAGGCGGTCAAAAGGGAGCAAGAGCCTATCGCATCGACTCCATCGAGGAATATCTCGCTGCC
TCTTTCGACCTGGAACGGCTCCATCTCATTCAAAACCGTCTATGGCTGGCCGGACTCCCCGTTCCCGCACGGTCG
TTGCATAGACAAAAGATACTCGGTCGCGAGATTGTCATCACGGATCAGTCAGACCTGCATCTCACCTGGCGTGAG
TCGACTCTCTTCCTCAAGCCCTTGTGGGAACCCCTTCTCGATCATGGTTTCTGGCGATATGAGCTCTGCAACAAA
GACGTCAAGACTTATCTCAGTGCCACTGGTCTTCTCATGTCTTACATCTGGCTCATCTGCTCCGAGCCAGACCTG
CTGATCGCAAAACAACACAACTTGGTGCCCCGTAAGCTCAACTGGGCAGCTTGGGCCTTCTTCTCCCGGGACTTC
CTCGACAGGCATTCTCTAGACGGACACAACGAGGACATGGCCAAACGATACGACTACGGCGAGTTACGAATCCAA
CGCCTCAACTTGATCTATCGGTTCGCGCCCGAGACGTTCCCAAACTATCTCCTCCGCGGCTATCTCTACGGCTAC
AACCAGTTCAGCCAGTTCTTCGGCCGTAACTTTGCCTGGGCGGCCGTGGCGGTGCTGTATGCTGGTGTCGTGCTG
GCGGCTATGCAGGTGGCGCTCGCCGTGCCTCCTATCAAGGACGACGTGAGTTTCCAGAGGGCGGCTTATGGATTT
ACCGTCTTCATTCTGGTTGCCATGGTCTTCTTCTCTACTTTCGCGCTGGCGTATCTTGTCATCGTGTTTAATTTG
AACCTCATCTTCACCAGACAGAAAGTCAGGCAACATGAGCAACGGGCAAAGGAAGCGACGAGGTCGAACAACGCC
CCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail