Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02778
Gene name
Locationscaffold_02:4734611..4736069
Strand-
Gene length (bp)1458
Transcript length (bp)1389
Coding sequence length (bp)1389
Protein length (aa) 463

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00487 FA_desaturase Fatty acid desaturase 5.5E-18 70 283
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 2.9E-16 348 412

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.5

Transmembrane Domains

Domain # Start End Length
1 39 61 22
2 68 90 22
3 103 120 17
4 186 208 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02778
MAAFDGTTDYTPLRSAKADLSKVHISDTPMTWSNWYKHINWLNTTFVVFIPLISFFAAYWVPLHRYTFIFGIFYY
FSTGLGITAGYHRLWAHTSYKATLPLKIFLAACGAGAVEGSIRWWSRDHRAHHRYTDTEKDPYSVRKGLLYSHMG
WMIFKQNPKRTGRTDISDLNEDPVVVWQHTHYLKSVIFMAFIFPTFFCGLLWGDWLGGFVFGGILRITVVQQATF
CVNSLAHWLGDQPFDDRNSPRDHVITAILTLGEGYHNFHHEFPSDYRNAIEWYQYDPTKWFICIWKLLGLAYDLK
EFRANEIEKGRVQQMQKKLDQKRATLDWGIPLEQLPVISWNDFVDGAKNGKALVAIAGVIHDVGAFIKDHPGGKA
LISSAIGKDATAIFNGGVYNHSNAAHNLLSTMRIGVLRGGCEVEIWKRAQFENKDVAYMNDSAGQRIVRAGSQVT
RMAQPVASADAA*
Coding >Ophcf2|02778
ATGGCCGCCTTTGATGGCACCACCGACTACACGCCGCTTCGGTCGGCAAAGGCGGATCTGTCAAAGGTGCACATT
TCCGACACGCCCATGACGTGGTCCAACTGGTACAAGCACATCAACTGGCTCAATACCACCTTTGTCGTCTTCATT
CCCTTGATCAGCTTCTTCGCTGCCTACTGGGTGCCGCTTCATCGGTACACCTTCATCTTTGGCATCTTCTACTAC
TTTAGCACCGGCCTCGGCATCACCGCTGGCTACCATCGACTCTGGGCCCATACCTCGTACAAGGCCACCCTCCCG
CTCAAAATCTTCCTCGCCGCCTGTGGTGCCGGTGCCGTCGAGGGATCCATTCGCTGGTGGTCCAGGGACCATCGT
GCCCATCACCGCTACACCGACACCGAAAAGGATCCCTACTCGGTCCGCAAGGGTCTCCTCTACTCCCACATGGGC
TGGATGATCTTCAAGCAGAATCCCAAGCGCACCGGCCGCACCGACATCTCGGACCTCAACGAGGACCCCGTCGTC
GTCTGGCAGCACACTCACTACCTCAAGTCGGTCATCTTCATGGCCTTCATCTTCCCCACCTTCTTCTGTGGCCTC
CTCTGGGGCGATTGGCTCGGTGGCTTCGTCTTTGGCGGCATCCTCCGAATCACCGTCGTCCAGCAGGCTACCTTT
TGCGTCAATTCGCTCGCTCACTGGCTCGGCGACCAGCCCTTTGACGACCGCAACTCGCCCCGAGACCACGTCATC
ACCGCCATCCTTACCCTCGGCGAGGGCTACCACAACTTCCATCACGAGTTCCCCTCGGATTACCGCAACGCCATC
GAGTGGTACCAGTACGATCCGACCAAGTGGTTCATATGCATCTGGAAGCTCCTCGGCCTCGCCTACGACCTCAAG
GAGTTCCGTGCCAACGAGATTGAAAAGGGCCGCGTCCAGCAGATGCAGAAGAAGCTCGACCAGAAGCGGGCGACG
CTCGACTGGGGCATTCCCCTCGAGCAGCTGCCCGTCATCAGCTGGAACGACTTCGTCGACGGTGCCAAGAACGGC
AAGGCCCTCGTCGCCATCGCCGGTGTCATCCACGACGTCGGTGCCTTTATCAAGGACCATCCTGGTGGCAAGGCC
CTCATCTCGTCGGCCATTGGCAAGGACGCCACCGCCATCTTCAACGGCGGCGTCTACAACCACTCCAACGCGGCC
CACAACCTGCTGTCCACCATGCGTATCGGCGTCCTGCGTGGTGGCTGCGAGGTGGAGATTTGGAAGCGTGCCCAG
TTCGAGAACAAGGACGTTGCCTACATGAATGACTCGGCCGGTCAGCGCATCGTCCGGGCCGGCTCCCAGGTCACC
AGGATGGCGCAGCCCGTGGCCAGTGCCGACGCCGCCTGA
Transcript >Ophcf2|02778
ATGGCCGCCTTTGATGGCACCACCGACTACACGCCGCTTCGGTCGGCAAAGGCGGATCTGTCAAAGGTGCACATT
TCCGACACGCCCATGACGTGGTCCAACTGGTACAAGCACATCAACTGGCTCAATACCACCTTTGTCGTCTTCATT
CCCTTGATCAGCTTCTTCGCTGCCTACTGGGTGCCGCTTCATCGGTACACCTTCATCTTTGGCATCTTCTACTAC
TTTAGCACCGGCCTCGGCATCACCGCTGGCTACCATCGACTCTGGGCCCATACCTCGTACAAGGCCACCCTCCCG
CTCAAAATCTTCCTCGCCGCCTGTGGTGCCGGTGCCGTCGAGGGATCCATTCGCTGGTGGTCCAGGGACCATCGT
GCCCATCACCGCTACACCGACACCGAAAAGGATCCCTACTCGGTCCGCAAGGGTCTCCTCTACTCCCACATGGGC
TGGATGATCTTCAAGCAGAATCCCAAGCGCACCGGCCGCACCGACATCTCGGACCTCAACGAGGACCCCGTCGTC
GTCTGGCAGCACACTCACTACCTCAAGTCGGTCATCTTCATGGCCTTCATCTTCCCCACCTTCTTCTGTGGCCTC
CTCTGGGGCGATTGGCTCGGTGGCTTCGTCTTTGGCGGCATCCTCCGAATCACCGTCGTCCAGCAGGCTACCTTT
TGCGTCAATTCGCTCGCTCACTGGCTCGGCGACCAGCCCTTTGACGACCGCAACTCGCCCCGAGACCACGTCATC
ACCGCCATCCTTACCCTCGGCGAGGGCTACCACAACTTCCATCACGAGTTCCCCTCGGATTACCGCAACGCCATC
GAGTGGTACCAGTACGATCCGACCAAGTGGTTCATATGCATCTGGAAGCTCCTCGGCCTCGCCTACGACCTCAAG
GAGTTCCGTGCCAACGAGATTGAAAAGGGCCGCGTCCAGCAGATGCAGAAGAAGCTCGACCAGAAGCGGGCGACG
CTCGACTGGGGCATTCCCCTCGAGCAGCTGCCCGTCATCAGCTGGAACGACTTCGTCGACGGTGCCAAGAACGGC
AAGGCCCTCGTCGCCATCGCCGGTGTCATCCACGACGTCGGTGCCTTTATCAAGGACCATCCTGGTGGCAAGGCC
CTCATCTCGTCGGCCATTGGCAAGGACGCCACCGCCATCTTCAACGGCGGCGTCTACAACCACTCCAACGCGGCC
CACAACCTGCTGTCCACCATGCGTATCGGCGTCCTGCGTGGTGGCTGCGAGGTGGAGATTTGGAAGCGTGCCCAG
TTCGAGAACAAGGACGTTGCCTACATGAATGACTCGGCCGGTCAGCGCATCGTCCGGGCCGGCTCCCAGGTCACC
AGGATGGCGCAGCCCGTGGCCAGTGCCGACGCCGCCTGA
Gene >Ophcf2|02778
ATGGCCGCCTTTGATGGCACCACCGACTACACGCCGCTTCGGTCGGCAAAGGCGGATCTGTCAAAGGTGCACATT
TCCGACACGCCCATGACGTGGTCCAACTGGTACAAGCACATCAACTGGCTCAATACCACCTTTGTCGTCTTCATT
CCCTTGATCAGCTTCTTCGCTGCCTACTGGGTGCCGCTTCATCGGTACACCTTCATCTTTGGCATCTTCTACTAC
TTTAGCACCGGCCTCGGCATCACCGCTGGTAAGAAATCCCCGACTTCCCCTCATTCTCGGTGCACCAGGACCAGA
GTCTTAACAAGCATCCCCACAGGCTACCATCGACTCTGGGCCCATACCTCGTACAAGGCCACCCTCCCGCTCAAA
ATCTTCCTCGCCGCCTGTGGTGCCGGTGCCGTCGAGGGATCCATTCGCTGGTGGTCCAGGGACCATCGTGCCCAT
CACCGCTACACCGACACCGAAAAGGATCCCTACTCGGTCCGCAAGGGTCTCCTCTACTCCCACATGGGCTGGATG
ATCTTCAAGCAGAATCCCAAGCGCACCGGCCGCACCGACATCTCGGACCTCAACGAGGACCCCGTCGTCGTCTGG
CAGCACACTCACTACCTCAAGTCGGTCATCTTCATGGCCTTCATCTTCCCCACCTTCTTCTGTGGCCTCCTCTGG
GGCGATTGGCTCGGTGGCTTCGTCTTTGGCGGCATCCTCCGAATCACCGTCGTCCAGCAGGCTACCTTTTGCGTC
AATTCGCTCGCTCACTGGCTCGGCGACCAGCCCTTTGACGACCGCAACTCGCCCCGAGACCACGTCATCACCGCC
ATCCTTACCCTCGGCGAGGGCTACCACAACTTCCATCACGAGTTCCCCTCGGATTACCGCAACGCCATCGAGTGG
TACCAGTACGATCCGACCAAGTGGTTCATATGCATCTGGAAGCTCCTCGGCCTCGCCTACGACCTCAAGGAGTTC
CGTGCCAACGAGATTGAAAAGGGCCGCGTCCAGCAGATGCAGAAGAAGCTCGACCAGAAGCGGGCGACGCTCGAC
TGGGGCATTCCCCTCGAGCAGCTGCCCGTCATCAGCTGGAACGACTTCGTCGACGGTGCCAAGAACGGCAAGGCC
CTCGTCGCCATCGCCGGTGTCATCCACGACGTCGGTGCCTTTATCAAGGACCATCCTGGTGGCAAGGCCCTCATC
TCGTCGGCCATTGGCAAGGACGCCACCGCCATCTTCAACGGCGGCGTCTACAACCACTCCAACGCGGCCCACAAC
CTGCTGTCCACCATGCGTATCGGCGTCCTGCGTGGTGGCTGCGAGGTGGAGATTTGGAAGCGTGCCCAGTTCGAG
AACAAGGACGTTGCCTACATGAATGACTCGGCCGGTCAGCGCATCGTCCGGGCCGGCTCCCAGGTCACCAGGATG
GCGCAGCCCGTGGCCAGTGCCGACGCCGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail