Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02775
Gene name
Locationscaffold_02:4728079..4728645
Strand+
Gene length (bp)566
Transcript length (bp)513
Coding sequence length (bp)513
Protein length (aa) 171

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03061 4HBT Thioesterase superfamily 9.6E-14 75 152

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Peroxisome Peroxisomal targeting signal 0.5392 0.5186 0.0533 0.0373 0.0899 0.0061 0.2445 0.2211 0.0454 0.9337

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5696
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4284
Ophiocordyceps australis map64 (Brazil) OphauB2|1233
Ophiocordyceps camponoti-floridani Ophcf2|02775 (this protein)
Ophiocordyceps kimflemingae Ophio5|2235
Ophiocordyceps subramaniannii Hirsu2|8674

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02775
MGSSSSENGQDDVLSDKINEWLQLTRTSQGHLKAGDYMEALIPHLQLHSVSPKARPPRVTFSYTVQPDHCNRMRN
LHGGAAATLYDYCTTLVLVSVSRPGFWNYLGVSRSLNVTYLRPAPCDEEVLIECHLLQVGKRLATLTGTMRRKSD
GEILSTCEHGKANIDPDAKL*
Coding >Ophcf2|02775
ATGGGCTCCTCCTCCAGCGAAAACGGCCAGGATGACGTCCTCTCAGACAAGATCAACGAATGGCTCCAGCTCACT
CGTACCAGCCAAGGCCACCTCAAGGCCGGAGACTACATGGAAGCCCTCATCCCCCATCTGCAATTACACAGCGTC
TCGCCCAAAGCCCGTCCGCCCCGCGTCACCTTTTCCTACACCGTCCAGCCCGATCACTGCAACCGAATGCGCAAC
CTTCACGGAGGTGCCGCCGCCACGCTCTACGATTACTGCACCACCCTAGTTCTCGTCTCCGTTAGTCGGCCGGGC
TTCTGGAATTACCTCGGTGTCAGCCGCTCACTCAACGTCACCTATCTACGTCCAGCTCCCTGCGACGAGGAGGTC
CTGATCGAGTGCCACCTTCTGCAGGTCGGCAAGAGACTGGCGACGCTGACGGGAACCATGAGAAGGAAAAGCGAT
GGCGAGATCCTGAGCACGTGCGAACACGGCAAGGCCAATATCGACCCCGACGCCAAACTGTAG
Transcript >Ophcf2|02775
ATGGGCTCCTCCTCCAGCGAAAACGGCCAGGATGACGTCCTCTCAGACAAGATCAACGAATGGCTCCAGCTCACT
CGTACCAGCCAAGGCCACCTCAAGGCCGGAGACTACATGGAAGCCCTCATCCCCCATCTGCAATTACACAGCGTC
TCGCCCAAAGCCCGTCCGCCCCGCGTCACCTTTTCCTACACCGTCCAGCCCGATCACTGCAACCGAATGCGCAAC
CTTCACGGAGGTGCCGCCGCCACGCTCTACGATTACTGCACCACCCTAGTTCTCGTCTCCGTTAGTCGGCCGGGC
TTCTGGAATTACCTCGGTGTCAGCCGCTCACTCAACGTCACCTATCTACGTCCAGCTCCCTGCGACGAGGAGGTC
CTGATCGAGTGCCACCTTCTGCAGGTCGGCAAGAGACTGGCGACGCTGACGGGAACCATGAGAAGGAAAAGCGAT
GGCGAGATCCTGAGCACGTGCGAACACGGCAAGGCCAATATCGACCCCGACGCCAAACTGTAG
Gene >Ophcf2|02775
ATGGGCTCCTCCTCCAGCGAAAACGGCCAGGATGACGTCCTCTCAGACAAGATCAACGAATGGCTCCAGCTCACT
CGTACCAGCCAAGGCCACCTCAAGGCCGGAGTAAGCCTCCGATGCTCTGTCACTTCATTGATGGCCGTGTCTCAT
CGAGATAGGACTACATGGAAGCCCTCATCCCCCATCTGCAATTACACAGCGTCTCGCCCAAAGCCCGTCCGCCCC
GCGTCACCTTTTCCTACACCGTCCAGCCCGATCACTGCAACCGAATGCGCAACCTTCACGGAGGTGCCGCCGCCA
CGCTCTACGATTACTGCACCACCCTAGTTCTCGTCTCCGTTAGTCGGCCGGGCTTCTGGAATTACCTCGGTGTCA
GCCGCTCACTCAACGTCACCTATCTACGTCCAGCTCCCTGCGACGAGGAGGTCCTGATCGAGTGCCACCTTCTGC
AGGTCGGCAAGAGACTGGCGACGCTGACGGGAACCATGAGAAGGAAAAGCGATGGCGAGATCCTGAGCACGTGCG
AACACGGCAAGGCCAATATCGACCCCGACGCCAAACTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail