Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02767
Gene name
Locationscaffold_02:4699536..4707566
Strand-
Gene length (bp)8030
Transcript length (bp)7197
Coding sequence length (bp)7197
Protein length (aa) 2399

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12257 IML1 Vacuolar membrane-associated protein Iml1 5.3E-115 194 505
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 2.6E-20 1975 2127
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 6.4E-23 2244 2384
PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP) 6.2E-25 1319 1393
PF19418 DEPDC5_CTD DEPDC5 protein C-terminal region 2.6E-11 1459 1632

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0005096 GTPase activator activity Yes
GO:0035556 intracellular signal transduction Yes
GO:0016021 integral component of membrane Yes
GO:0008047 enzyme activator activity No
GO:0050794 regulation of cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0050789 regulation of biological process No
GO:0030695 GTPase regulator activity No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0031224 intrinsic component of membrane No
GO:0051179 localization No
GO:0098772 molecular function regulator activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0007165 signal transduction No
GO:0065007 biological regulation No
GO:0030234 enzyme regulator activity No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 1972 1994 22
2 2007 2029 22
3 2039 2061 22
4 2068 2090 22
5 2105 2127 22
6 2241 2263 22
7 2278 2300 22
8 2307 2329 22
9 2344 2363 19
10 2368 2390 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02767
MSRNLPATPSGSRRGPRWSHLRQPSGAPVDRASSTEPPGSSCSTSTRSTTKDIRPRCAEKYCNVAVNEGYSRDEV
LLNLDLIAIDVRPGSLMSLTPVRGDSSRAPSGSMGKQTPESCDGSKLTAPCGCYAELDCGHSRYIFLVKDMPKEL
KFRQPDVEVYVVKHIADAFNIKKGSQVLLTPVEKDRPATEASHVELTFKDQYLTRADMWRLTIGELIQRTVYKGQ
SILFLGTVKAQVTDVFVDGKQVHSAFFVRDTRPIFRSESARYVLFIQMAREMWDFDPDGSGEIIFNKVVNGFLPA
LFKRWVLLKVKHLVSIVLFARVEYDVGLTNELASSALHSDYYTGIQPSGHRRPYKDFYRVVVSQMASGEWTKILY
QLKKELNFFRRDISLHHHANSESLNPGVDEQGMKRDGALSRVKAESSLSIHGNVLEAINLAASQFAHDYIDRDLM
RTGISIAVITPGPGVFEVDYESLSRTTEALVGNGIGIDLICMPRMPLHSAPLFKYRNPQYSEDRAPAGAQGLSRS
FQSRDGTPSQPTPVVGSFQSMASSFSPTKASTVTRRMETLAATAASEEWCYALPQWLHVSFWTGTSDEALSYAGI
ALTVSNQVSKDDQDEFKVRCRMYNLQMKSFLDANEIEAAPLQTDPQYPTQTINKSSSSKRPQGRLGDVLYRPLRR
RPDTLFDNVIGFQKFVPERLAQPGEKHLWRQLQEFDDSRSRLPAVSRQHHSGKHHKAESDDMIRRQNVAEVAVLG
SSFPEQTPVSLAPEPRKLSIATVDGETVNLSAAKRTADPMTPAAKAMLKPPKLMRHISLGHRGFGIAAPKVAAAE
VKTETVSAAAVSTGERTPRPLSELTPSSPQSTMRSQPPSLSSQQRLKSETGDAAVEAFPSTPSIPIVKRDGHLIS
TGSKLAPTSPAGIPRGGRFEDGDTGYTSVLRVDDAQKLYTSKLRAGVVPELPSTLSPKTAMTPWLSLLNPSNPEG
HRIDDTVLYSRWQHVFPRTSDMKVQKWKTLCRPAAVPLTTEYFPSKAQFDVEYQRHPYNVDQNLDDEAVDEPRSR
REFMRELIGMRFSQGFQVVVGSSVAQAFGQKLIKVADVFSRDQPLEDGASVFMSVGNTIHQLSCINGTEVEVNIY
VRKPTQPLPSTTGFSTTYKPAIRTLLDSEYETRHIDMLLPRPERNWNTIDSYLAGHHEEMMEGLRFWRARFVLIP
LSANHPSLQRSQSGDNPEELRIEGIKRLAQMWQKNRYLPPADRRFQPRENRQNPLDIVYKTEDPSVVIAAELETL
PLVEGQEGAQRRNKLVTRKERFQKSHLSLTALAEAMQQPVESGGVPLRNRRWHLRLHKASFIGSDMTTWLLDNFE
DLADREEAEQLGNALMVMAEGDRGLFVHVEKRHRFRDGNYFYQMAAEFARPQPGWFSSRRREASVPPTPMSETGA
RDSPLARATEGGQSPASTATLSGPFGAKNNRPRVVLSKMIKYDMDPRRRSYRPERIDLHYDRLHNPDNCFHMRID
WLNATSKLVQDVVESWEREAGQYGLGLVEVPIQEACRITDSNPLRKPYAIALAERPPDEKPEAYQDASSQGPQTA
PSRHFYQTALLRTFDFVLDTEAASSFPTNVDVRYSWGKPEYRHTQFIHRSGTLLAQITDGGDLVVLANRLYNKSA
GGGRDRDRERMARMTGLEPSSVSSPMMRPALYRQSPAGAPADGGCPTAGWAAPQAESIKAQLESFCRDAPGLRAF
YREALDKGRRVRGTPWSAAATTTTEGVTEAQIPSLGLPPGVLGAGAGAGEGLGPGLRRRVRRRRVRGWEVRLRRC
GGGPGMASPYSDTGHGVGCLHPLLADKEKTLLLANQHSQQTLKSSAARRGLIDTAYEVPTYLSIHSSASCTNRFP
AFPASFMSLNHFRNRRQAHAVSRTSSDQAWNPFRHVWGERAQTWAGGESLSVTTGDRCHDTPVAAGEKKEVKTPD
SWINTLLIAAPVGIAINYVPSVPRVAVFIVNFVAIVPLAAMLSFATEEIALRTGETLGGLLNATFGNAVEVIVSI
IALLEGKIQIVKTSLIGSILSNLLLVMGCCFFFGGLRRPEQHFNTIVAQTAASLLALAAASVIVPTVFDAAQNTP
PAKVAALSRGTAVILLIVYAAYLFFQLKTHHTVFSQESQKVPAKPWATHATTTTTTMPRGNVHKAVVVPGSLMGG
GLQGEDANRRLSRMLMNPLRFDKNGDIKERAANEDANSQDEEGEEEGEEEEEEEEEEEEEAQLHFAVALATLTLS
TAIIALCAEFMVSSIDAVTQNGNLSEEFLGLILLPIVGNAAEHATAVTVAMKDKMDLAIGVAVGSSMQIALFVIP
FIVLVGWGLGDDAMNLSFDFFQTATMFMAVLLANYLIGDGKSHWLEGFLLICLYAIIGVCAFYYPNSAADQTA*
Coding >Ophcf2|02767
ATGTCACGAAACCTCCCTGCCACGCCGTCTGGCTCGCGCAGGGGGCCGCGATGGTCTCATCTCCGCCAGCCGAGC
GGCGCCCCCGTCGACCGAGCCTCGTCGACCGAACCTCCGGGCTCTTCTTGCAGCACGTCGACACGATCTACAACC
AAGGATATCAGGCCGCGCTGCGCTGAGAAATACTGCAATGTCGCCGTTAACGAAGGTTACTCCAGAGACGAGGTT
CTGCTCAACCTCGACCTAATCGCCATCGATGTCCGTCCCGGATCGCTCATGTCCCTGACGCCGGTCCGAGGTGAT
TCGTCCAGAGCCCCGTCTGGAAGCATGGGAAAGCAGACCCCGGAGAGCTGCGATGGCTCTAAGCTCACGGCCCCT
TGCGGCTGCTACGCTGAGCTCGATTGTGGTCATAGCCGTTACATCTTCCTCGTCAAGGATATGCCCAAGGAGCTC
AAGTTCCGCCAGCCCGACGTTGAGGTTTACGTAGTAAAGCACATTGCCGACGCCTTCAACATAAAAAAGGGCTCC
CAAGTGCTTCTGACGCCTGTAGAAAAGGACCGCCCTGCCACAGAGGCGTCTCACGTCGAACTGACCTTTAAGGAC
CAGTATCTGACGAGGGCAGATATGTGGCGACTGACCATTGGCGAGCTAATCCAGCGGACCGTCTACAAGGGACAA
TCTATACTCTTCCTCGGCACCGTCAAGGCTCAAGTCACGGACGTTTTCGTCGACGGCAAGCAGGTTCATTCCGCG
TTTTTTGTCCGCGATACCCGTCCCATATTTCGTAGCGAGTCCGCGCGATACGTCTTGTTTATACAGATGGCTAGG
GAGATGTGGGACTTTGACCCGGACGGCTCCGGCGAAATCATATTCAACAAAGTCGTCAACGGGTTCTTGCCGGCC
TTGTTTAAGCGCTGGGTCCTTCTCAAGGTGAAACACCTTGTTAGCATCGTCCTCTTTGCTCGTGTCGAGTACGAC
GTCGGGCTCACCAACGAGCTCGCCAGCAGCGCCTTGCATTCCGACTATTACACGGGTATCCAGCCCTCGGGCCAC
CGTCGACCGTACAAGGACTTTTACCGCGTCGTTGTCAGCCAGATGGCCAGCGGAGAGTGGACCAAGATCCTTTAC
CAGCTCAAGAAGGAGCTCAACTTCTTTCGCAGAGACATAAGCCTACACCACCACGCCAATAGCGAGTCTCTCAAT
CCCGGTGTCGATGAACAGGGCATGAAAAGGGACGGGGCGCTGTCCCGGGTCAAGGCTGAGTCGTCCCTTTCGATA
CACGGCAACGTGCTAGAAGCCATCAACCTCGCGGCCTCGCAGTTCGCGCACGACTATATTGACAGGGACCTGATG
CGTACCGGCATCTCCATTGCCGTCATCACGCCGGGGCCGGGTGTCTTCGAGGTGGATTACGAGAGCTTGAGCCGG
ACGACTGAGGCGCTCGTCGGCAACGGCATCGGCATCGACCTCATCTGCATGCCCAGGATGCCGCTACACTCGGCG
CCGCTCTTCAAATATCGGAATCCCCAGTATAGCGAAGACAGGGCGCCTGCCGGGGCCCAGGGCCTGTCTCGGTCG
TTTCAAAGTCGCGATGGAACGCCCAGCCAGCCGACACCCGTGGTCGGAAGCTTCCAGTCCATGGCAAGCTCCTTT
TCGCCCACAAAGGCCTCGACCGTGACACGTCGCATGGAGACGCTGGCCGCGACGGCGGCAAGCGAAGAGTGGTGC
TACGCGCTGCCCCAGTGGCTGCACGTGTCTTTCTGGACAGGCACGTCGGACGAGGCGCTGTCTTACGCAGGCATC
GCCCTGACCGTCTCCAACCAGGTCAGCAAAGATGATCAGGATGAGTTCAAGGTTCGCTGCCGGATGTACAATCTA
CAGATGAAGAGCTTCCTGGACGCCAACGAGATTGAGGCTGCGCCGCTGCAGACGGATCCCCAATATCCGACCCAG
ACCATCAATAAAAGCTCCAGCTCGAAGCGTCCTCAAGGCCGGCTGGGCGACGTCTTGTATAGGCCTCTTCGTCGC
CGGCCAGACACTCTGTTTGATAACGTCATCGGCTTTCAGAAGTTCGTGCCTGAAAGACTGGCTCAGCCCGGAGAG
AAGCACCTATGGAGGCAGTTGCAAGAGTTTGACGACTCGCGGAGCCGCTTACCGGCCGTCTCCAGGCAACATCAC
TCTGGGAAGCATCACAAGGCCGAGTCGGACGACATGATTCGCAGGCAAAACGTGGCAGAAGTGGCCGTCTTGGGA
TCGTCGTTCCCGGAGCAGACGCCCGTCTCTCTGGCGCCGGAGCCGAGGAAGCTCTCTATCGCCACTGTTGATGGG
GAGACGGTGAATCTGTCCGCCGCAAAGAGGACGGCAGACCCGATGACGCCCGCGGCAAAGGCGATGCTGAAGCCG
CCGAAACTGATGAGACACATCAGCCTCGGGCATCGAGGATTTGGCATCGCCGCGCCCAAAGTTGCGGCAGCCGAG
GTCAAGACGGAGACTGTAAGCGCCGCGGCCGTCTCTACGGGGGAACGGACGCCGCGGCCGCTATCGGAGCTCACG
CCGTCTTCACCGCAGTCGACGATGCGCAGTCAGCCGCCGTCACTGTCGTCGCAGCAACGGCTGAAGAGCGAGACG
GGCGACGCCGCGGTGGAAGCATTCCCTTCGACACCGAGCATCCCCATCGTCAAGCGAGACGGTCATCTCATCTCG
ACGGGCAGCAAGCTGGCACCGACATCGCCGGCCGGCATCCCACGCGGGGGCAGGTTCGAAGACGGTGACACGGGC
TACACGAGCGTGCTACGGGTTGACGACGCTCAGAAGCTGTACACGAGCAAGCTGCGAGCCGGGGTGGTGCCGGAG
CTGCCCTCCACGCTGTCGCCCAAGACGGCCATGACGCCCTGGCTGAGCCTGCTGAACCCGTCCAACCCGGAGGGT
CACCGGATCGACGACACGGTCCTGTACAGCAGGTGGCAGCACGTCTTCCCCCGGACGTCGGACATGAAGGTTCAG
AAGTGGAAGACGCTCTGTCGTCCTGCAGCGGTGCCCCTGACGACGGAGTATTTTCCCTCCAAGGCGCAGTTTGAC
GTGGAATACCAGAGGCACCCTTACAACGTGGACCAGAATCTCGACGACGAGGCGGTGGACGAGCCGAGGTCACGT
AGAGAGTTTATGAGGGAGCTCATCGGCATGCGATTCTCTCAGGGCTTTCAAGTGGTGGTCGGGTCGTCGGTGGCC
CAGGCCTTTGGGCAGAAGCTGATCAAGGTGGCCGACGTCTTCTCTCGCGACCAGCCGCTGGAAGATGGGGCCAGC
GTGTTCATGTCGGTGGGCAACACGATACACCAGCTCTCGTGCATCAACGGTACCGAGGTCGAGGTCAACATTTAC
GTGCGGAAGCCGACTCAACCGCTGCCGTCGACGACGGGCTTCTCGACGACGTATAAGCCGGCGATCCGGACGCTG
CTGGATTCCGAGTACGAGACGCGGCACATCGACATGCTCCTCCCGAGGCCGGAGCGGAACTGGAACACGATCGAC
TCGTACCTCGCGGGTCACCATGAGGAGATGATGGAGGGTCTTCGATTCTGGCGGGCGCGGTTCGTGCTGATACCG
CTCAGCGCCAATCACCCGTCGCTGCAGCGGTCTCAGAGCGGCGACAACCCGGAGGAGCTCAGGATCGAAGGGATC
AAGCGGCTGGCGCAGATGTGGCAGAAGAACCGCTACCTGCCGCCGGCCGACAGGCGCTTCCAGCCGCGCGAAAAC
CGCCAGAACCCGCTGGATATCGTTTACAAGACGGAGGATCCATCCGTGGTGATTGCGGCGGAGCTGGAGACGCTC
CCGCTGGTGGAGGGTCAGGAGGGCGCCCAGCGGCGGAACAAGCTGGTGACGAGAAAGGAGAGGTTCCAGAAGTCG
CACTTGAGCCTGACAGCGCTGGCCGAGGCCATGCAGCAGCCGGTAGAGAGCGGAGGGGTGCCTCTGCGGAACCGG
CGGTGGCACCTGAGGCTTCACAAGGCGTCGTTTATCGGGTCTGACATGACGACGTGGCTACTGGATAACTTTGAG
GATCTGGCAGACCGCGAAGAGGCCGAGCAGCTGGGCAACGCGCTCATGGTGATGGCCGAAGGGGATCGGGGGCTG
TTTGTACACGTCGAGAAGCGGCACCGGTTCCGGGACGGCAACTACTTTTACCAGATGGCGGCCGAGTTCGCGCGG
CCTCAGCCTGGTTGGTTCAGTTCGAGGCGGAGGGAGGCTTCGGTGCCGCCGACGCCCATGTCGGAGACGGGAGCT
CGGGACTCGCCGCTGGCACGGGCGACGGAGGGCGGGCAATCACCGGCGTCCACGGCGACGCTGTCCGGGCCTTTT
GGGGCCAAGAACAACCGGCCGCGAGTTGTGCTCAGCAAGATGATCAAGTACGACATGGACCCTCGTCGTCGATCT
TACCGTCCGGAGCGTATCGACCTTCACTACGACCGGCTGCACAACCCAGACAACTGCTTCCACATGCGGATCGAC
TGGCTCAACGCGACGTCGAAGCTGGTGCAGGACGTGGTAGAGAGCTGGGAGCGCGAGGCCGGACAGTACGGGCTA
GGGCTCGTCGAGGTTCCGATCCAGGAGGCGTGCCGGATCACGGATTCGAACCCGCTGCGGAAGCCGTACGCGATT
GCGCTGGCGGAGCGGCCACCGGACGAGAAGCCCGAGGCGTACCAAGACGCGAGCTCGCAGGGACCGCAGACGGCC
CCGAGCCGGCACTTTTACCAGACGGCCTTGTTGCGAACCTTTGACTTTGTTCTCGATACGGAGGCGGCTTCGAGC
TTCCCTACGAACGTGGACGTCCGGTATTCATGGGGCAAGCCCGAATACCGGCACACGCAGTTCATTCACCGGTCG
GGCACGTTGCTGGCGCAGATTACGGATGGAGGTGACTTGGTCGTGCTGGCGAACCGGCTGTACAACAAGAGCGCG
GGAGGAGGCCGCGACCGGGACAGGGAGCGGATGGCGCGCATGACGGGTCTGGAGCCGTCGTCTGTATCATCACCG
ATGATGCGACCAGCGCTATACCGACAATCACCGGCGGGAGCTCCAGCGGACGGCGGATGCCCAACAGCAGGATGG
GCAGCACCACAAGCAGAGAGCATCAAGGCACAACTGGAGAGCTTCTGCCGAGACGCACCGGGACTACGAGCATTC
TACAGAGAAGCACTGGACAAGGGCCGACGCGTACGGGGCACGCCATGGTCCGCAGCAGCGACGACGACGACGGAG
GGCGTGACGGAGGCGCAGATCCCGTCGCTGGGGCTGCCTCCGGGGGTTCTCGGGGCCGGGGCCGGGGCCGGGGAA
GGGCTGGGGCCGGGGCTCCGGAGACGGGTCCGGAGGAGGCGAGTCCGCGGGTGGGAAGTCCGCTTACGGCGTTGC
GGAGGGGGACCTGGAATGGCCTCCCCGTATTCCGATACCGGACATGGCGTCGGTTGCCTGCATCCTCTGTTAGCC
GACAAAGAAAAGACGCTTCTCCTCGCCAACCAACACTCACAGCAAACTCTGAAATCCAGCGCTGCCCGACGAGGC
CTGATCGACACAGCCTACGAAGTACCTACCTACCTATCCATCCATTCATCTGCCAGCTGTACGAACCGATTCCCT
GCTTTCCCTGCTTCCTTCATGTCTCTCAACCACTTCCGCAACAGAAGGCAGGCCCACGCCGTCAGCCGCACCAGC
TCAGACCAGGCCTGGAATCCGTTCCGGCATGTTTGGGGGGAGAGGGCGCAGACGTGGGCTGGCGGCGAGAGCCTG
AGTGTCACGACGGGGGATCGTTGTCATGATACGCCTGTTGCGGCTGGGGAGAAGAAAGAGGTCAAGACTCCCGAC
TCATGGATCAACACGCTGCTCATAGCCGCGCCCGTCGGCATAGCAATCAACTACGTGCCTTCCGTCCCGCGCGTA
GCCGTCTTCATCGTCAACTTCGTCGCCATCGTACCCCTCGCCGCCATGCTGAGCTTTGCGACGGAGGAGATTGCC
TTGCGGACGGGAGAGACGTTGGGGGGGTTGCTCAACGCCACGTTTGGGAACGCCGTCGAGGTCATCGTCAGCATC
ATTGCTTTGCTCGAGGGCAAGATTCAGATTGTCAAGACGTCGCTTATCGGCTCTATCCTTTCGAATCTCCTCCTC
GTCATGGGCTGCTGCTTCTTCTTCGGCGGTCTCCGCCGTCCAGAACAACACTTCAACACAATAGTCGCCCAAACA
GCCGCCTCCCTCCTCGCCCTGGCCGCCGCCTCCGTCATCGTCCCGACCGTCTTCGACGCCGCACAAAACACGCCT
CCCGCAAAAGTGGCCGCCTTATCCCGCGGCACAGCCGTCATCCTCCTCATCGTCTACGCAGCCTACCTCTTCTTC
CAGCTCAAGACGCACCACACCGTCTTCAGCCAGGAGAGTCAAAAGGTTCCGGCTAAGCCTTGGGCCACGCATGCG
ACGACGACGACGACGACGATGCCTAGAGGGAATGTTCACAAGGCGGTCGTGGTGCCCGGTTCGTTGATGGGGGGT
GGGTTGCAGGGGGAGGATGCCAATCGACGGCTCTCGCGAATGTTGATGAATCCTCTTCGCTTCGATAAGAATGGC
GACATTAAAGAAAGGGCCGCAAACGAAGACGCAAACAGCCAAGACGAAGAAGGAGAAGAAGAAGGAGAAGAAGAA
GAAGAAGAAGAAGAAGAAGAAGAAGAAGAGGCACAACTACACTTCGCCGTCGCCCTCGCAACCCTAACCCTCTCA
ACCGCAATAATAGCCCTCTGCGCAGAATTCATGGTCTCCTCCATCGACGCCGTGACCCAAAACGGCAACCTCTCC
GAAGAATTCCTCGGCCTAATCCTCCTCCCCATCGTCGGCAACGCCGCCGAGCACGCCACGGCCGTGACGGTGGCC
ATGAAGGACAAGATGGATCTCGCCATCGGCGTGGCCGTCGGATCGAGCATGCAGATCGCCCTCTTCGTCATCCCC
TTTATCGTCCTGGTCGGATGGGGACTCGGCGACGATGCCATGAATCTTAGCTTTGATTTCTTTCAGACGGCTACC
ATGTTCATGGCCGTGCTGCTGGCCAATTATCTGATTGGTGATGGTAAGAGTCATTGGCTGGAGGGCTTTCTGCTC
ATTTGTCTCTATGCCATCATCGGCGTCTGCGCTTTCTATTATCCCAATTCGGCCGCCGATCAGACGGCTTGA
Transcript >Ophcf2|02767
ATGTCACGAAACCTCCCTGCCACGCCGTCTGGCTCGCGCAGGGGGCCGCGATGGTCTCATCTCCGCCAGCCGAGC
GGCGCCCCCGTCGACCGAGCCTCGTCGACCGAACCTCCGGGCTCTTCTTGCAGCACGTCGACACGATCTACAACC
AAGGATATCAGGCCGCGCTGCGCTGAGAAATACTGCAATGTCGCCGTTAACGAAGGTTACTCCAGAGACGAGGTT
CTGCTCAACCTCGACCTAATCGCCATCGATGTCCGTCCCGGATCGCTCATGTCCCTGACGCCGGTCCGAGGTGAT
TCGTCCAGAGCCCCGTCTGGAAGCATGGGAAAGCAGACCCCGGAGAGCTGCGATGGCTCTAAGCTCACGGCCCCT
TGCGGCTGCTACGCTGAGCTCGATTGTGGTCATAGCCGTTACATCTTCCTCGTCAAGGATATGCCCAAGGAGCTC
AAGTTCCGCCAGCCCGACGTTGAGGTTTACGTAGTAAAGCACATTGCCGACGCCTTCAACATAAAAAAGGGCTCC
CAAGTGCTTCTGACGCCTGTAGAAAAGGACCGCCCTGCCACAGAGGCGTCTCACGTCGAACTGACCTTTAAGGAC
CAGTATCTGACGAGGGCAGATATGTGGCGACTGACCATTGGCGAGCTAATCCAGCGGACCGTCTACAAGGGACAA
TCTATACTCTTCCTCGGCACCGTCAAGGCTCAAGTCACGGACGTTTTCGTCGACGGCAAGCAGGTTCATTCCGCG
TTTTTTGTCCGCGATACCCGTCCCATATTTCGTAGCGAGTCCGCGCGATACGTCTTGTTTATACAGATGGCTAGG
GAGATGTGGGACTTTGACCCGGACGGCTCCGGCGAAATCATATTCAACAAAGTCGTCAACGGGTTCTTGCCGGCC
TTGTTTAAGCGCTGGGTCCTTCTCAAGGTGAAACACCTTGTTAGCATCGTCCTCTTTGCTCGTGTCGAGTACGAC
GTCGGGCTCACCAACGAGCTCGCCAGCAGCGCCTTGCATTCCGACTATTACACGGGTATCCAGCCCTCGGGCCAC
CGTCGACCGTACAAGGACTTTTACCGCGTCGTTGTCAGCCAGATGGCCAGCGGAGAGTGGACCAAGATCCTTTAC
CAGCTCAAGAAGGAGCTCAACTTCTTTCGCAGAGACATAAGCCTACACCACCACGCCAATAGCGAGTCTCTCAAT
CCCGGTGTCGATGAACAGGGCATGAAAAGGGACGGGGCGCTGTCCCGGGTCAAGGCTGAGTCGTCCCTTTCGATA
CACGGCAACGTGCTAGAAGCCATCAACCTCGCGGCCTCGCAGTTCGCGCACGACTATATTGACAGGGACCTGATG
CGTACCGGCATCTCCATTGCCGTCATCACGCCGGGGCCGGGTGTCTTCGAGGTGGATTACGAGAGCTTGAGCCGG
ACGACTGAGGCGCTCGTCGGCAACGGCATCGGCATCGACCTCATCTGCATGCCCAGGATGCCGCTACACTCGGCG
CCGCTCTTCAAATATCGGAATCCCCAGTATAGCGAAGACAGGGCGCCTGCCGGGGCCCAGGGCCTGTCTCGGTCG
TTTCAAAGTCGCGATGGAACGCCCAGCCAGCCGACACCCGTGGTCGGAAGCTTCCAGTCCATGGCAAGCTCCTTT
TCGCCCACAAAGGCCTCGACCGTGACACGTCGCATGGAGACGCTGGCCGCGACGGCGGCAAGCGAAGAGTGGTGC
TACGCGCTGCCCCAGTGGCTGCACGTGTCTTTCTGGACAGGCACGTCGGACGAGGCGCTGTCTTACGCAGGCATC
GCCCTGACCGTCTCCAACCAGGTCAGCAAAGATGATCAGGATGAGTTCAAGGTTCGCTGCCGGATGTACAATCTA
CAGATGAAGAGCTTCCTGGACGCCAACGAGATTGAGGCTGCGCCGCTGCAGACGGATCCCCAATATCCGACCCAG
ACCATCAATAAAAGCTCCAGCTCGAAGCGTCCTCAAGGCCGGCTGGGCGACGTCTTGTATAGGCCTCTTCGTCGC
CGGCCAGACACTCTGTTTGATAACGTCATCGGCTTTCAGAAGTTCGTGCCTGAAAGACTGGCTCAGCCCGGAGAG
AAGCACCTATGGAGGCAGTTGCAAGAGTTTGACGACTCGCGGAGCCGCTTACCGGCCGTCTCCAGGCAACATCAC
TCTGGGAAGCATCACAAGGCCGAGTCGGACGACATGATTCGCAGGCAAAACGTGGCAGAAGTGGCCGTCTTGGGA
TCGTCGTTCCCGGAGCAGACGCCCGTCTCTCTGGCGCCGGAGCCGAGGAAGCTCTCTATCGCCACTGTTGATGGG
GAGACGGTGAATCTGTCCGCCGCAAAGAGGACGGCAGACCCGATGACGCCCGCGGCAAAGGCGATGCTGAAGCCG
CCGAAACTGATGAGACACATCAGCCTCGGGCATCGAGGATTTGGCATCGCCGCGCCCAAAGTTGCGGCAGCCGAG
GTCAAGACGGAGACTGTAAGCGCCGCGGCCGTCTCTACGGGGGAACGGACGCCGCGGCCGCTATCGGAGCTCACG
CCGTCTTCACCGCAGTCGACGATGCGCAGTCAGCCGCCGTCACTGTCGTCGCAGCAACGGCTGAAGAGCGAGACG
GGCGACGCCGCGGTGGAAGCATTCCCTTCGACACCGAGCATCCCCATCGTCAAGCGAGACGGTCATCTCATCTCG
ACGGGCAGCAAGCTGGCACCGACATCGCCGGCCGGCATCCCACGCGGGGGCAGGTTCGAAGACGGTGACACGGGC
TACACGAGCGTGCTACGGGTTGACGACGCTCAGAAGCTGTACACGAGCAAGCTGCGAGCCGGGGTGGTGCCGGAG
CTGCCCTCCACGCTGTCGCCCAAGACGGCCATGACGCCCTGGCTGAGCCTGCTGAACCCGTCCAACCCGGAGGGT
CACCGGATCGACGACACGGTCCTGTACAGCAGGTGGCAGCACGTCTTCCCCCGGACGTCGGACATGAAGGTTCAG
AAGTGGAAGACGCTCTGTCGTCCTGCAGCGGTGCCCCTGACGACGGAGTATTTTCCCTCCAAGGCGCAGTTTGAC
GTGGAATACCAGAGGCACCCTTACAACGTGGACCAGAATCTCGACGACGAGGCGGTGGACGAGCCGAGGTCACGT
AGAGAGTTTATGAGGGAGCTCATCGGCATGCGATTCTCTCAGGGCTTTCAAGTGGTGGTCGGGTCGTCGGTGGCC
CAGGCCTTTGGGCAGAAGCTGATCAAGGTGGCCGACGTCTTCTCTCGCGACCAGCCGCTGGAAGATGGGGCCAGC
GTGTTCATGTCGGTGGGCAACACGATACACCAGCTCTCGTGCATCAACGGTACCGAGGTCGAGGTCAACATTTAC
GTGCGGAAGCCGACTCAACCGCTGCCGTCGACGACGGGCTTCTCGACGACGTATAAGCCGGCGATCCGGACGCTG
CTGGATTCCGAGTACGAGACGCGGCACATCGACATGCTCCTCCCGAGGCCGGAGCGGAACTGGAACACGATCGAC
TCGTACCTCGCGGGTCACCATGAGGAGATGATGGAGGGTCTTCGATTCTGGCGGGCGCGGTTCGTGCTGATACCG
CTCAGCGCCAATCACCCGTCGCTGCAGCGGTCTCAGAGCGGCGACAACCCGGAGGAGCTCAGGATCGAAGGGATC
AAGCGGCTGGCGCAGATGTGGCAGAAGAACCGCTACCTGCCGCCGGCCGACAGGCGCTTCCAGCCGCGCGAAAAC
CGCCAGAACCCGCTGGATATCGTTTACAAGACGGAGGATCCATCCGTGGTGATTGCGGCGGAGCTGGAGACGCTC
CCGCTGGTGGAGGGTCAGGAGGGCGCCCAGCGGCGGAACAAGCTGGTGACGAGAAAGGAGAGGTTCCAGAAGTCG
CACTTGAGCCTGACAGCGCTGGCCGAGGCCATGCAGCAGCCGGTAGAGAGCGGAGGGGTGCCTCTGCGGAACCGG
CGGTGGCACCTGAGGCTTCACAAGGCGTCGTTTATCGGGTCTGACATGACGACGTGGCTACTGGATAACTTTGAG
GATCTGGCAGACCGCGAAGAGGCCGAGCAGCTGGGCAACGCGCTCATGGTGATGGCCGAAGGGGATCGGGGGCTG
TTTGTACACGTCGAGAAGCGGCACCGGTTCCGGGACGGCAACTACTTTTACCAGATGGCGGCCGAGTTCGCGCGG
CCTCAGCCTGGTTGGTTCAGTTCGAGGCGGAGGGAGGCTTCGGTGCCGCCGACGCCCATGTCGGAGACGGGAGCT
CGGGACTCGCCGCTGGCACGGGCGACGGAGGGCGGGCAATCACCGGCGTCCACGGCGACGCTGTCCGGGCCTTTT
GGGGCCAAGAACAACCGGCCGCGAGTTGTGCTCAGCAAGATGATCAAGTACGACATGGACCCTCGTCGTCGATCT
TACCGTCCGGAGCGTATCGACCTTCACTACGACCGGCTGCACAACCCAGACAACTGCTTCCACATGCGGATCGAC
TGGCTCAACGCGACGTCGAAGCTGGTGCAGGACGTGGTAGAGAGCTGGGAGCGCGAGGCCGGACAGTACGGGCTA
GGGCTCGTCGAGGTTCCGATCCAGGAGGCGTGCCGGATCACGGATTCGAACCCGCTGCGGAAGCCGTACGCGATT
GCGCTGGCGGAGCGGCCACCGGACGAGAAGCCCGAGGCGTACCAAGACGCGAGCTCGCAGGGACCGCAGACGGCC
CCGAGCCGGCACTTTTACCAGACGGCCTTGTTGCGAACCTTTGACTTTGTTCTCGATACGGAGGCGGCTTCGAGC
TTCCCTACGAACGTGGACGTCCGGTATTCATGGGGCAAGCCCGAATACCGGCACACGCAGTTCATTCACCGGTCG
GGCACGTTGCTGGCGCAGATTACGGATGGAGGTGACTTGGTCGTGCTGGCGAACCGGCTGTACAACAAGAGCGCG
GGAGGAGGCCGCGACCGGGACAGGGAGCGGATGGCGCGCATGACGGGTCTGGAGCCGTCGTCTGTATCATCACCG
ATGATGCGACCAGCGCTATACCGACAATCACCGGCGGGAGCTCCAGCGGACGGCGGATGCCCAACAGCAGGATGG
GCAGCACCACAAGCAGAGAGCATCAAGGCACAACTGGAGAGCTTCTGCCGAGACGCACCGGGACTACGAGCATTC
TACAGAGAAGCACTGGACAAGGGCCGACGCGTACGGGGCACGCCATGGTCCGCAGCAGCGACGACGACGACGGAG
GGCGTGACGGAGGCGCAGATCCCGTCGCTGGGGCTGCCTCCGGGGGTTCTCGGGGCCGGGGCCGGGGCCGGGGAA
GGGCTGGGGCCGGGGCTCCGGAGACGGGTCCGGAGGAGGCGAGTCCGCGGGTGGGAAGTCCGCTTACGGCGTTGC
GGAGGGGGACCTGGAATGGCCTCCCCGTATTCCGATACCGGACATGGCGTCGGTTGCCTGCATCCTCTGTTAGCC
GACAAAGAAAAGACGCTTCTCCTCGCCAACCAACACTCACAGCAAACTCTGAAATCCAGCGCTGCCCGACGAGGC
CTGATCGACACAGCCTACGAAGTACCTACCTACCTATCCATCCATTCATCTGCCAGCTGTACGAACCGATTCCCT
GCTTTCCCTGCTTCCTTCATGTCTCTCAACCACTTCCGCAACAGAAGGCAGGCCCACGCCGTCAGCCGCACCAGC
TCAGACCAGGCCTGGAATCCGTTCCGGCATGTTTGGGGGGAGAGGGCGCAGACGTGGGCTGGCGGCGAGAGCCTG
AGTGTCACGACGGGGGATCGTTGTCATGATACGCCTGTTGCGGCTGGGGAGAAGAAAGAGGTCAAGACTCCCGAC
TCATGGATCAACACGCTGCTCATAGCCGCGCCCGTCGGCATAGCAATCAACTACGTGCCTTCCGTCCCGCGCGTA
GCCGTCTTCATCGTCAACTTCGTCGCCATCGTACCCCTCGCCGCCATGCTGAGCTTTGCGACGGAGGAGATTGCC
TTGCGGACGGGAGAGACGTTGGGGGGGTTGCTCAACGCCACGTTTGGGAACGCCGTCGAGGTCATCGTCAGCATC
ATTGCTTTGCTCGAGGGCAAGATTCAGATTGTCAAGACGTCGCTTATCGGCTCTATCCTTTCGAATCTCCTCCTC
GTCATGGGCTGCTGCTTCTTCTTCGGCGGTCTCCGCCGTCCAGAACAACACTTCAACACAATAGTCGCCCAAACA
GCCGCCTCCCTCCTCGCCCTGGCCGCCGCCTCCGTCATCGTCCCGACCGTCTTCGACGCCGCACAAAACACGCCT
CCCGCAAAAGTGGCCGCCTTATCCCGCGGCACAGCCGTCATCCTCCTCATCGTCTACGCAGCCTACCTCTTCTTC
CAGCTCAAGACGCACCACACCGTCTTCAGCCAGGAGAGTCAAAAGGTTCCGGCTAAGCCTTGGGCCACGCATGCG
ACGACGACGACGACGACGATGCCTAGAGGGAATGTTCACAAGGCGGTCGTGGTGCCCGGTTCGTTGATGGGGGGT
GGGTTGCAGGGGGAGGATGCCAATCGACGGCTCTCGCGAATGTTGATGAATCCTCTTCGCTTCGATAAGAATGGC
GACATTAAAGAAAGGGCCGCAAACGAAGACGCAAACAGCCAAGACGAAGAAGGAGAAGAAGAAGGAGAAGAAGAA
GAAGAAGAAGAAGAAGAAGAAGAAGAAGAGGCACAACTACACTTCGCCGTCGCCCTCGCAACCCTAACCCTCTCA
ACCGCAATAATAGCCCTCTGCGCAGAATTCATGGTCTCCTCCATCGACGCCGTGACCCAAAACGGCAACCTCTCC
GAAGAATTCCTCGGCCTAATCCTCCTCCCCATCGTCGGCAACGCCGCCGAGCACGCCACGGCCGTGACGGTGGCC
ATGAAGGACAAGATGGATCTCGCCATCGGCGTGGCCGTCGGATCGAGCATGCAGATCGCCCTCTTCGTCATCCCC
TTTATCGTCCTGGTCGGATGGGGACTCGGCGACGATGCCATGAATCTTAGCTTTGATTTCTTTCAGACGGCTACC
ATGTTCATGGCCGTGCTGCTGGCCAATTATCTGATTGGTGATGGTAAGAGTCATTGGCTGGAGGGCTTTCTGCTC
ATTTGTCTCTATGCCATCATCGGCGTCTGCGCTTTCTATTATCCCAATTCGGCCGCCGATCAGACGGCTTGA
Gene >Ophcf2|02767
ATGTCACGAAACCTCCCTGCCACGCCGTCTGGCTCGCGCAGGGGGCCGCGATGGTCTCATCTCCGCCAGCCGAGC
GGCGCCCCCGTCGACCGAGCCTCGTCGACCGAACCTCCGGGCTCTTCTTGCAGCACGTCGACACGATCTACAACC
AAGGATATCAGGCCGCGCTGCGCTGAGAAATACTGCAATGTCGCCGTTAACGAAGGTTACTCCAGAGACGAGGTT
CTGCTCAACCTCGACCTAATCGCCATCGATGTCCGTCCCGGATCGCTCATGTCCCTGACGCCGGTCCGAGGTGAT
TCGTCCAGAGCCCCGTCTGGAAGCATGGGAAAGCAGACCCCGGAGAGCTGCGATGGCTCTAAGCTCACGGCCCCT
TGCGGCTGCTACGCTGAGCTCGATTGTGGTCATAGCCGTTACATCTTCCTCGTCAAGGATATGCCCAAGGAGCTC
AAGTTCCGCCAGCCCGACGTTGAGGTTTACGTAGTAAAGCACATTGCCGACGCCTTCAACATAAAAAAGGGCTCC
CAAGTGCTTCTGACGCCTGTAAGTCATCACCAAGCTCTGCGTCCCCTTCCCCGGCTGACTTGAACCACAAGGTAG
AAAAGGACCGCCCTGCCACAGAGGCGTCTCACGTCGAACTGACCTTTAAGGACCAGTATCTGACGAGGGCAGATA
TGTGGCGACTGACCATTGGCGAGCTAATCCAGCGGACCGTCTACAAGGGACAATCTATACTCTTCCTCGGCACCG
TCAAGGCTCAAGTCACGGACGTTTTCGTCGACGGCAAGCAGGTTCATTCCGCGTTTTTTGTCCGCGATACCCGTC
CCATATTTCGTAGCGAGTCCGCGCGATACGTCTTGTTTATACAGATGGCTAGGGAGATGTGGGACTTTGACCCGG
ACGGCTCCGGCGAAATCATATTCAACAAAGTCGTCAACGGGTTCTTGCCGGCCTTGTTTAAGCGCTGGGTCCTTC
TCAAGGTGAAACACCTTGTTAGCATCGTCCTCTTTGCTCGTGTCGAGTACGACGTCGGGCTCACCAACGAGCTCG
CCAGCAGCGCCTTGCATTCCGACTATTACACGGGTATCCAGCCCTCGGGCCACCGTCGACCGTACAAGGACTTTT
ACCGCGTCGTTGTCAGCCAGATGGCCAGCGGAGAGTGGACCAAGATCCTTTACCAGCTCAAGAAGGAGCTCAACT
TCTTTCGCAGAGACATAAGCCTACACCACCACGCCAATAGCGAGTCTCTCAATCCCGGTGTCGATGAACAGGGCA
TGAAAAGGGACGGGGCGCTGTCCCGGGTCAAGGCTGAGTCGTCCCTTTCGATACACGGCAACGTGCTAGAAGCCA
TCAACCTCGCGGCCTCGCAGTTCGCGCACGACTATATTGACAGGGACCTGATGCGTACCGGCATCTCCATTGCCG
TCATCACGCCGGGGCCGGGTGTCTTCGAGGTGGATTACGAGAGCTTGAGCCGGACGACTGAGGCGCTCGTCGGCA
ACGGCATCGGCATCGACCTCATCTGCATGCCCAGGATGCCGCTACACTCGGCGCCGCTCTTCAAATATCGGAATC
CCCAGTATAGCGAAGACAGGGCGCCTGCCGGGGCCCAGGGCCTGTCTCGGTCGTTTCAAAGTCGCGATGGAACGC
CCAGCCAGCCGACACCCGTGGTCGGAAGCTTCCAGTCCATGGCAAGCTCCTTTTCGCCCACAAAGGCCTCGACCG
TGACACGTCGCATGGAGACGCTGGCCGCGACGGCGGCAAGCGAAGAGTGGTGCTACGCGCTGCCCCAGTGGCTGC
ACGTGTCTTTCTGGACAGGCACGTCGGACGAGGCGCTGTCTTACGCAGGCATCGCCCTGACCGTCTCCAACCAGG
TCAGCAAAGATGATCAGGATGAGTTCAAGGTTCGCTGCCGGATGTACAATCTACAGATGAAGAGCTTCCTGGACG
CCAACGAGATTGAGGCTGCGCCGCTGCAGACGGATCCCCAATATCCGACCCAGACCATCAATAAAAGCTCCAGCT
CGAAGCGTCCTCAAGGCCGGCTGGGCGACGTCTTGTATAGGCCTCTTCGTCGCCGGCCAGACACTCTGTTTGATA
ACGTCATCGGCTTTCAGAAGTTCGTGCCTGAAAGACTGGCTCAGCCCGGAGAGAAGCACCTATGGAGGCAGTTGC
AAGAGTTTGACGACTCGCGGAGCCGCTTACCGGCCGTCTCCAGGCAACATCACTCTGGGAAGCATCACAAGGCCG
AGTCGGACGACATGATTCGCAGGCAAAACGTGGCAGAAGTGGCCGTCTTGGGATCGTCGTTCCCGGAGCAGACGC
CCGTCTCTCTGGCGCCGGAGCCGAGGAAGCTCTCTATCGCCACTGTTGATGGGGAGACGGTGAATCTGTCCGCCG
CAAAGAGGACGGCAGACCCGATGACGCCCGCGGCAAAGGCGATGCTGAAGCCGCCGAAACTGATGAGACACATCA
GCCTCGGGCATCGAGGATTTGGCATCGCCGCGCCCAAAGTTGCGGCAGCCGAGGTCAAGACGGAGACTGTAAGCG
CCGCGGCCGTCTCTACGGGGGAACGGACGCCGCGGCCGCTATCGGAGCTCACGCCGTCTTCACCGCAGTCGACGA
TGCGCAGTCAGCCGCCGTCACTGTCGTCGCAGCAACGGCTGAAGAGCGAGACGGGCGACGCCGCGGTGGAAGCAT
TCCCTTCGACACCGAGCATCCCCATCGTCAAGCGAGACGGTCATCTCATCTCGACGGGCAGCAAGCTGGCACCGA
CATCGCCGGCCGGCATCCCACGCGGGGGCAGGTTCGAAGACGGTGACACGGGCTACACGAGCGTGCTACGGGTTG
ACGACGCTCAGAAGCTGTACACGAGCAAGCTGCGAGCCGGGGTGGTGCCGGAGCTGCCCTCCACGCTGTCGCCCA
AGACGGCCATGACGCCCTGGCTGAGCCTGCTGAACCCGTCCAACCCGGAGGGTCACCGGATCGACGACACGGTCC
TGTACAGCAGGTGGCAGCACGTCTTCCCCCGGACGTCGGACATGAAGGTTCAGAAGTGGAAGACGCTCTGTCGTC
CTGCAGCGGTGCCCCTGACGACGGAGTATTTTCCCTCCAAGGCGCAGTTTGACGTGGAATACCAGAGGCACCCTT
ACAACGTGGACCAGAATCTCGACGACGAGGCGGTGGACGAGCCGAGGTCACGTAGAGAGTTTATGAGGGAGCTCA
TCGGCATGCGATTCTCTCAGGGCTTTCAAGTGGTGGTCGGGTCGTCGGTGGCCCAGGCCTTTGGGCAGAAGCTGA
TCAAGGTGGCCGACGTCTTCTCTCGCGACCAGCCGCTGGAAGATGGGGCCAGCGTGTTCATGTCGGTGGGCAACA
CGATACACCAGCTCTCGTGCATCAACGGTACCGAGGTCGAGGTCAACATTTACGTGCGGAAGCCGACTCAACCGC
TGCCGTCGACGACGGGCTTCTCGACGACGTATAAGCCGGCGATCCGGACGCTGCTGGATTCCGAGTACGAGACGC
GGCACATCGACATGCTCCTCCCGAGGCCGGAGCGGAACTGGAACACGATCGACTCGTACCTCGCGGGTCACCATG
AGGAGATGATGGAGGGTCTTCGATTCTGGCGGGCGCGGTTCGTGCTGATACCGCTCAGCGCCAATCACCCGTCGC
TGCAGCGGTCTCAGAGCGGCGACAACCCGGAGGAGCTCAGGATCGAAGGGATCAAGCGGCTGGCGCAGATGTGGC
AGAAGAACCGCTACCTGCCGCCGGCCGACAGGCGCTTCCAGCCGCGCGAAAACCGCCAGAACCCGCTGGATATCG
TTTACAAGACGGAGGATCCATCCGTGGTGATTGCGGCGGAGCTGGAGACGCTCCCGCTGGTGGAGGGTCAGGAGG
GCGCCCAGCGGCGGAACAAGCTGGTGACGAGAAAGGAGAGGTTCCAGAAGTCGCACTTGAGCCTGACAGCGCTGG
CCGAGGCCATGCAGCAGCCGGTAGAGAGCGGAGGGGTGCCTCTGCGGAACCGGCGGTGGCACCTGAGGCTTCACA
AGGCGTCGTTTATCGGGTCTGACATGACGACGTGGCTACTGGATAACTTTGAGGATCTGGCAGACCGCGAAGAGG
CCGAGCAGCTGGGCAACGCGCTCATGGTGATGGCCGAAGGGGATCGGGGGCTGTTTGTACACGTCGAGAAGCGGC
ACCGGTTCCGGGACGGCAACTACTTTTACCAGATGGCGGCCGAGTTCGCGCGGCCTCAGCCTGGTTGGTTCAGTT
CGAGGCGGAGGGAGGCTTCGGTGCCGCCGACGCCCATGTCGGAGACGGGAGCTCGGGACTCGCCGCTGGCACGGG
CGACGGAGGGCGGGCAATCACCGGCGTCCACGGCGACGCTGTCCGGGCCTTTTGGGGCCAAGAACAACCGGCCGC
GAGTTGTGCTCAGCAAGATGATCAAGTACGACATGGACCCTCGTCGTCGATCTTACCGTCCGGAGCGTATCGACC
TTCACTACGACCGGCTGCACAACCCAGACAACTGCTTCCACATGCGGATCGACTGGCTCAACGCGACGTCGAAGC
TGGTGCAGGACGTGGTAGAGAGCTGGGAGCGCGAGGCCGGACAGTACGGGCTAGGGCTCGTCGAGGTTCCGATCC
AGGAGGCGTGCCGGATCACGGATTCGAACCCGCTGCGGAAGCCGTACGCGATTGCGCTGGCGGAGCGGCCACCGG
ACGAGAAGCCCGAGGCGTACCAAGACGCGAGCTCGCAGGGACCGCAGACGGCCCCGAGCCGGCACTTTTACCAGA
CGGCCTTGTTGCGAACCTTTGACTTTGTTCTCGATACGGAGGCGGCTTCGAGCTTCCCTACGAACGTGGACGTCC
GGTATTCATGGGGCAAGCCCGAATACCGGCACACGCAGTTCATTCACCGGTCGGGCACGTTGCTGGCGCAGATTA
CGGATGGAGGTGACTTGGTCGTGCTGGCGAACCGGCTGTACAACAAGAGCGCGGGAGGAGGCCGCGACCGGGACA
GGGAGCGGATGGCGCGCATGACGGGTCTGGAGCCGTCGTCTGTATCATCACCGATGATGCGACCAGCGCTATACC
GACAATCACCGGCGGGAGCTCCAGCGGACGGCGGATGCCCAACAGCAGGATGGGCAGCACCACAAGCAGAGAGCA
TCAAGGCACAACTGGAGAGCTTCTGCCGAGACGCACCGGGACTACGAGCATTCTACAGAGAAGCACTGGACAAGG
GCCGACGCGTACGGGGCACGCCATGGTCCGCAGCAGCGACGACGACGACGGAGGGCGTGACGGAGGCGCAGATCC
CGTCGCTGGGGCTGCCTCCGGGGGTTCTCGGGGCCGGGGCCGGGGCCGGGGAAGGGCTGGGGCCGGGGCTCCGGA
GACGGGTCCGGAGGAGGCGAGTCCGCGGGTGGGAAGTCCGCTTACGGCGTTGCGGAGGGGGAGTGTGTTGCTGGA
TGGGTCGTCGAGGGGGAAGTGAGGTAAGGGTGGTCACGTGGAGACGCGACGCGTGGTAAGACGTCATGGGTGAGG
TGACCTGACGCTGTGAGTTGAGTACCTGCCTACCTACCTAATACCTACCTACCTAATACCTACCTACCTAATACC
TACCTACCTAATACCTAGTTGTTGACTGTCTTTCTCACCGTCAGTGTCAATATAGCCTGGAATGGCCTCCCCGTA
TTCCGATACCGGACATGGCGTCGGTTGCCTGCATCCTCTGTTAGCCGGTACGCGTCACGCAGAAATTAACCCCCT
TTGCCCTTGATTCACAAGTCACAAGACAAAGAAAAGACGCTTCTCCTCGCCAACCAACACTCACAGCAAACTCTG
AAATCCAGCGCTGCCCGACGAGGCCTGATCGACACAGCCTACGAAGTACCTACCTACCTATCCATCCATTCATCT
GCCAGCTGTACGAACCGATTCCCTGCTTTCCCTGCTTCCTTCATGTCTCGTAAGTTTTGCATGACGTCCTCACAC
TTTTCTTTTTTTCCATCTATCCATCTATCTATCCATCTATCCATCCATCCTACCATCACCCCTCCCTCCTTCACT
CCCTCCCTCCCTCCCTGCATACCCGCGCCTTCTCCTCAAAACCTCAACCTCCATCTAACATAACATCATGACGAC
AGTCAACCACTTCCGCAACAGAAGGCAGGCCCACGCCGTCAGCCGCACCAGCTCAGACCAGGCCTGGAATCCGTT
CCGGCATGTTTGGGGGGAGAGGGCGCAGACGTGGGCTGGCGGCGAGAGCCTGAGTGTCACGACGGGGGATCGTTG
TCATGATACGCCTGTTGCGGCTGGGGAGAAGAAAGAGGTCAAGACTCCCGAGTTGGAGGATGGCAACCGTCTGGC
CCCGTCTGGAGCGGGCCGAGAAGGAAGGCAAAGGCAACAAGTTCACGATCCCCCCCAACACAAAAGCCTCAACCC
CCCCCCCAAAAGGCCTCCTCCGCAAAATCCAACCCAAAACTCCCTTCACAACCTCCAACCAACTCCAACGGACCT
TTCTCAGCTCATGGATCAACACGCTGCTCATAGCCGCGCCCGTCGGCATAGCAATCAACTACGTGCCTTCCGTCC
CGCGCGTAGCCGTCTTCATCGTCAACTTCGTCGCCATCGTACCCCTCGCCGCCATGCTGAGCTTTGCGACGGAGG
AGATTGCCTTGCGGACGGGAGAGACGTTGGGGGGGTTGCTCAACGCCACGTTTGGGAACGCCGTCGAGGTCATCG
TCAGCATCATTGCTTTGCTCGAGGGCAAGATTCAGATTGTCAAGACGTCGCTTATCGTGAGTCACGTTTCTTTCC
CTCTCCTCCCTTCCTCTGATCTGACGAGGTTTCTGACAATGTCTAGGGCTCTATCCTTTCGAATCTCCTCCTCGT
CATGGGCTGCTGCTTCTTCTTCGGCGGTCTCCGCCGTCCAGAACAACACTTCAACACAATAGTCGCCCAAACAGC
CGCCTCCCTCCTCGCCCTGGCCGCCGCCTCCGTCATCGTCCCGACCGTCTTCGACGCCGCACAAAACACGCCTCC
CGCAAAAGTGGCCGCCTTATCCCGCGGCACAGCCGTCATCCTCCTCATCGTCTACGCAGCCTACCTCTTCTTCCA
GCTCAAGACGCACCACACCGTCTTCAGCCAGGAGAGTCAAAAGGTTCCGGCTAAGCCTTGGGCCACGCATGCGAC
GACGACGACGACGACGATGCCTAGAGGGAATGTTCACAAGGCGGTCGTGGTGCCCGGTTCGTTGATGGGGGGTGG
GTTGCAGGGGGAGGATGCCAATCGACGGCTCTCGCGAATGTTGATGAATCCTCTTCGCTTCGATAAGAATGGCGA
CATTAAAGAAAGGGCCGCAAACGAAGACGCAAACAGCCAAGACGAAGAAGGAGAAGAAGAAGGAGAAGAAGAAGA
AGAAGAAGAAGAAGAAGAAGAAGAAGAGGCACAACTACACTTCGCCGTCGCCCTCGCAACCCTAACCCTCTCAAC
CGCAATAATAGCCCTCTGCGCAGAATTCATGGTCTCCTCCATCGACGCCGTGACCCAAAACGGCAACCTCTCCGA
AGAATTCCTCGGCCTAATCCTCCTCCCCATCGTCGGCAACGCCGCCGAGCACGCCACGGCCGTGACGGTGGCCAT
GAAGGACAAGATGGATCTCGCCATCGGCGTGGCCGTCGGATCGAGCATGCAGATCGCCCTCTTCGTCATCCCCTT
TATCGTCCTGGTCGGATGGGGACTCGGCGACGATGCCATGAATCTTAGCTTTGATTTCTTTCAGACGGCTACCAT
GTTCATGGCCGTGCTGCTGGCCAATTATCTGATTGGTGATGGTAAGAGTCATTGGCTGGAGGGCTTTCTGCTCAT
TTGTCTCTATGCCATCATCGGCGTCTGCGCTTTCTGTGAGTCCTTCCCGTCTGTTCTTTTCTTTCTTTCTCCCCT
CGTGTTACCACCGTCTTTTGACTCACCTTGTCATTCTCATTACAGATTATCCCAATTCGGCCGCCGATCAGACGG
CTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail