Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02766
Gene name
Locationscaffold_02:4693517..4699124
Strand+
Gene length (bp)5607
Transcript length (bp)5499
Coding sequence length (bp)5499
Protein length (aa) 1833

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12830 Nipped-B_C Sister chromatid cohesion C-terminus 2.7E-45 1430 1618
PF12765 Cohesin_HEAT HEAT repeat associated with sister chromatid cohesion 3.2E-06 954 995

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1903 0.9374 0.3005 0.0545 0.0402 0.0163 0.0244 0.0052 0.0191 0.001

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1552
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4410
Ophiocordyceps australis map64 (Brazil) OphauB2|1213
Ophiocordyceps camponoti-floridani Ophcf2|02766 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1189
Ophiocordyceps kimflemingae Ophio5|2897
Ophiocordyceps subramaniannii Hirsu2|11275

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02766
MLPRASNGPENGVHALQAPSQPHPAISRPFTLQESLPYSPQTSMTPLLPDVIPDPTLGSGSPALPISGLFPRDEF
DRVNAEALNHPQGSRTLKQAADYVLHDLKPSQRTQYKFSAVPSGPPGMTPGKSLSQGLSPMTRNVYDRVGSFFKS
TKANVTGPKTNGDSHEPLKSVKQSPSLGSKAPPNVQNRRSEKPESHRSPSFRIEVAIPAKKAFDPSSYIEVASSA
QPDPIPRSVSQELPAKAKPSASNNGLTTFKESSPAGGKNLAFSIELPKANIKKEEYVEVCEVPYAPTSLSTRRPE
AQDVNPNQGVTVTSLDQRQRSEVALEAFDALFRSISGAVGSAYAMEPGTEHIVTMTADQEPVMTSATQQKLHGAI
QKIIDLRCFDSVALETLLHIVKLCEPTLRQVESLEFRVDESWDEGAVESWVQQLSELETALKAARTCLRLLSGGR
EDKQLYSESTIQRCVDLFKSVTEDLVIPLVELRPSSSLFKSVQKHKKAVSSTFVCCQKLFALLAELVTKIELSES
VINTLEYTSSKLIFVENAYFEKDSAIGPQRFDGIRSVAMDMLCQIFLIKPEQRQGIIDDILTSLEKLPVGKQSSR
QFKLSDGGSIQPVSALIMRLVQASSGRVNVDHGSGRAAILQRINGTDAGEGEAPTASKKSQSPWTVTTESHGAQQ
HAVAMQELGASAAPLAEAASRNASYVINFIVKRAIGSTKTGDTPYRNLLDLFVDDFTTCLDSPDWPSAELLLRLL
MFMMVQLFEAGKTAAPAKNMALELLGSMSAAISRLRSHVKKTAGSFEGSDTSELSQYLSELALLVLEHKSQVEHI
STWTGPYRVSLEYVQDRCAEDPHLAAAASYMVTNWANKLHIAYDNAQESDDERDREFGRMAYRLRMMIEDRKWLS
GQYTFKAVSASQARFAYSIMLLQSPLFEAFGKIVNILLGSMASDQATVRSKSLKSIHQVLETDPSILDGDSTVIQ
LILDCASDSSTQVRDSALGLLGNCIGMRRALESSLTPRIIERFQDAGVGVRKRAMKLARDIYLRNRSKTLRSAIA
NGLLRRVQDPDEGVRDLSRQMIEEVWFAPFYSNENTAAFETSLGEHVALIIQTVKTGTVTEVLDKVFQTVLRPQN
RSLEGPFSVCSRLVGTMFGMIDNPDSEDTTVPSGRDALQVLTIFAKADPKLFNFEQIRLLKPQLASFSGREELAA
FRAVTVIYKRVLPQLPTVHAEFLAEVRLQLLKAIGKIFSRVALDDLIACTQAVCELLKDFAPLANLVASSLLGIQ
KLGKGRLDKRGLGQLCAYAIIVGSVGKHSDLDQQLQVFRDRFPQWKGDSVPRLIVDMLAPFASPTQTLEARKAAI
EAIGLVCQSWPRNYVLAKVYTAFQQVFQDQVQALEALVLRSFKEFLMTEEKRSEAGIEAGSGDKKKELTIMGGTN
FDDVASATTQRFLKDMTRIALGSQDEHAFLAMEVLSSINRQGLTHPKETGLTLMTLETSANRKIAELAYMEHRAL
HEKHETVLEREYIKAVQSAYGYQRDVVQDCRGATKEPLQSKLHLLMEVLKISKMKNRQRFLEKLCGQIDFDLARL
EEMTAGGLPEHVGFSRFVIESVAFIEFQTVGEVQTTVNALEKIAAGTGATVAQAIESEVFNLRMDADEAANETMV
TTTEATIRPKVEPRRLRQLAAASVVLLLVWETRTHLRKLYGMGTHRHDSKAKALAKDLNKTPTKVQGVHGERLWD
ELTNHMGGLDSEERMATKCRELVELMTVDKEFQVADKDSGDDDMAADGPATPSDGDDGEEAPERGRKRKGAATPG
GRKKRARSGSQPRKRGRPRKQSEEADMDGDWI*
Coding >Ophcf2|02766
ATGCTGCCGCGCGCATCCAACGGGCCCGAGAATGGGGTCCACGCGCTTCAGGCTCCCTCACAACCTCATCCCGCC
ATCTCGCGACCCTTTACGCTGCAAGAGTCGCTGCCTTACTCGCCGCAGACGTCGATGACACCCCTTCTTCCTGAT
GTCATTCCCGATCCGACCTTGGGATCCGGTTCGCCCGCTCTGCCCATCTCGGGCCTCTTCCCACGAGACGAGTTC
GACAGGGTCAACGCCGAGGCCCTGAATCACCCGCAAGGTTCGAGGACCTTGAAGCAGGCTGCAGACTATGTGCTG
CACGACCTGAAGCCGTCACAAAGAACTCAATACAAATTCTCGGCCGTACCCTCCGGGCCCCCTGGCATGACCCCC
GGGAAAAGCCTTTCTCAGGGTCTCTCGCCCATGACCAGAAACGTATACGACCGAGTGGGCAGTTTCTTCAAGTCG
ACCAAAGCCAATGTTACAGGTCCCAAGACGAATGGCGACTCCCATGAGCCGCTGAAATCAGTTAAACAATCTCCA
TCGCTCGGCTCCAAAGCTCCTCCAAATGTGCAAAACAGACGATCAGAGAAACCTGAGTCACATAGATCCCCCTCC
TTTAGGATAGAGGTGGCTATCCCTGCGAAAAAGGCCTTTGATCCGAGTTCTTATATCGAAGTTGCGAGCTCCGCC
CAACCGGACCCGATTCCGCGGTCGGTGTCTCAGGAGCTTCCAGCGAAAGCCAAGCCTTCTGCTTCCAACAACGGC
CTCACAACCTTCAAAGAGTCATCCCCTGCGGGCGGAAAGAACTTGGCCTTTAGCATAGAGCTGCCCAAGGCCAAC
ATCAAGAAGGAAGAGTATGTCGAGGTTTGTGAGGTGCCGTACGCTCCCACAAGCCTCTCGACCCGGCGACCGGAA
GCACAGGACGTCAATCCTAACCAGGGCGTTACCGTCACCAGCCTTGATCAGCGACAGAGGAGCGAGGTGGCCCTG
GAGGCCTTTGACGCGCTTTTTCGATCCATCAGTGGTGCGGTGGGAAGCGCTTACGCCATGGAACCAGGGACGGAG
CACATCGTAACCATGACGGCGGACCAGGAGCCCGTCATGACCTCGGCCACGCAGCAAAAGCTGCACGGCGCCATT
CAAAAGATTATTGATCTGAGGTGCTTCGATAGTGTAGCTCTGGAGACCTTGCTGCACATCGTCAAGCTGTGCGAA
CCAACGCTGAGACAAGTTGAAAGTCTGGAGTTTCGCGTCGACGAGAGCTGGGATGAAGGGGCCGTCGAGTCTTGG
GTCCAGCAGCTATCTGAGCTGGAAACGGCGTTGAAAGCTGCGCGCACTTGCTTGCGCTTGCTCTCCGGAGGTCGC
GAAGACAAGCAACTGTATTCGGAGTCGACTATTCAACGGTGCGTTGACCTCTTCAAGTCAGTCACCGAAGACTTG
GTCATACCCTTGGTCGAGCTGCGACCGTCTTCGAGCCTTTTCAAGTCGGTACAGAAACACAAAAAGGCCGTCTCG
TCGACCTTTGTCTGTTGCCAGAAGCTGTTTGCTCTGCTTGCGGAGCTCGTGACCAAGATCGAGCTCTCCGAGTCA
GTTATCAACACCCTCGAGTACACGTCATCCAAACTCATCTTCGTGGAGAATGCATACTTTGAGAAGGACTCTGCC
ATCGGTCCTCAGAGGTTTGACGGTATCCGGTCCGTTGCCATGGATATGCTCTGCCAAATATTTCTCATCAAGCCT
GAGCAGAGGCAGGGCATCATCGACGACATACTCACCTCGCTCGAAAAGCTCCCCGTCGGAAAGCAGAGCTCGAGA
CAGTTCAAGCTCTCCGACGGCGGAAGCATCCAGCCCGTCTCGGCTCTCATAATGCGTCTGGTTCAGGCAAGCTCC
GGAAGGGTCAACGTCGACCACGGAAGCGGGCGGGCTGCTATCCTTCAGCGCATCAATGGGACAGACGCGGGCGAA
GGGGAAGCGCCAACCGCGTCCAAGAAGAGCCAGTCTCCGTGGACGGTGACGACGGAATCACATGGTGCCCAGCAA
CACGCTGTGGCCATGCAAGAGCTGGGAGCAAGCGCAGCGCCCCTTGCCGAGGCAGCGAGTCGGAACGCATCCTAC
GTCATCAACTTCATCGTCAAGCGAGCCATCGGCTCTACCAAGACCGGGGATACGCCGTACCGAAACCTGCTGGAT
CTGTTCGTGGACGACTTTACAACCTGCCTCGATTCGCCGGACTGGCCGTCGGCGGAGCTCCTGCTTCGACTCTTG
ATGTTCATGATGGTGCAGCTGTTCGAGGCCGGAAAGACGGCCGCTCCCGCGAAGAACATGGCACTGGAGTTGCTC
GGCTCTATGAGCGCCGCAATCTCGCGTCTGCGATCGCACGTGAAGAAGACGGCGGGATCTTTCGAGGGAAGCGAC
ACCAGTGAGCTATCGCAGTACCTCTCGGAGCTGGCCTTGCTCGTTCTCGAGCACAAGAGCCAGGTCGAGCACATC
AGCACGTGGACGGGGCCCTACAGAGTGTCCCTGGAATACGTTCAGGACCGTTGCGCTGAGGATCCTCATCTGGCG
GCGGCGGCGTCGTACATGGTGACGAACTGGGCAAATAAGCTCCATATCGCCTATGATAATGCCCAGGAGAGCGAC
GACGAACGGGATCGGGAGTTTGGTCGCATGGCTTACCGGCTGCGGATGATGATTGAGGATCGGAAATGGCTGTCT
GGTCAGTACACGTTCAAAGCCGTGTCAGCGAGTCAGGCCAGGTTCGCATACTCCATCATGCTCCTACAGTCTCCC
CTCTTCGAGGCCTTTGGCAAGATTGTCAACATCCTGTTGGGTTCTATGGCGAGCGATCAGGCGACGGTGCGGAGC
AAGAGTCTGAAGAGCATTCATCAAGTGCTGGAGACGGATCCGTCCATTCTCGACGGCGACTCGACCGTCATACAG
CTGATACTCGACTGTGCCAGTGATTCCTCCACGCAGGTGCGAGACTCGGCGCTCGGCCTGCTGGGAAACTGTATA
GGGATGCGTCGGGCTCTCGAATCGTCGCTAACTCCTAGAATCATAGAGAGGTTCCAGGACGCAGGCGTGGGAGTG
AGGAAAAGGGCCATGAAGCTGGCACGCGACATCTACCTCCGCAACCGAAGTAAGACGCTTCGCAGCGCCATCGCC
AACGGACTCCTACGTCGAGTACAGGATCCGGACGAGGGCGTACGCGATCTCTCGAGGCAGATGATCGAGGAGGTC
TGGTTTGCGCCCTTTTACTCAAACGAAAACACGGCCGCGTTCGAGACGTCGCTCGGGGAGCACGTTGCCCTCATC
ATCCAGACGGTCAAGACGGGGACCGTGACCGAGGTTCTCGACAAGGTGTTTCAGACGGTGCTCAGGCCCCAGAAC
AGGTCGCTCGAAGGACCCTTTTCAGTGTGTTCGAGGCTGGTCGGCACCATGTTTGGCATGATCGACAACCCCGAT
TCGGAAGATACCACGGTCCCTTCCGGACGCGACGCTTTGCAGGTTCTCACCATCTTCGCCAAGGCGGACCCCAAG
CTCTTCAACTTTGAACAGATCCGGCTGCTCAAGCCTCAACTGGCGAGCTTCTCTGGCCGCGAGGAGCTGGCAGCC
TTTCGGGCGGTGACGGTGATTTACAAGCGGGTGCTTCCGCAGCTGCCCACGGTACACGCAGAGTTCCTGGCCGAG
GTCCGGCTTCAGCTTCTCAAGGCCATCGGTAAGATCTTCTCGCGCGTCGCTCTCGACGACTTGATTGCCTGTACG
CAAGCCGTCTGCGAGCTGCTCAAGGACTTTGCGCCTCTGGCCAACCTCGTCGCGTCGAGCCTTCTGGGCATCCAG
AAGCTGGGCAAGGGTAGGCTGGACAAGAGAGGACTCGGGCAGCTGTGCGCCTACGCCATCATCGTGGGGAGCGTC
GGCAAGCACTCGGACCTGGATCAACAGCTTCAGGTCTTTCGGGATCGGTTTCCTCAGTGGAAGGGAGACTCTGTC
CCTCGTCTCATCGTCGACATGCTCGCGCCATTTGCCTCGCCCACGCAGACGCTGGAGGCTCGCAAGGCGGCCATC
GAGGCCATCGGGCTGGTGTGTCAGTCGTGGCCTCGCAACTACGTCCTGGCCAAGGTCTATACCGCCTTTCAGCAG
GTATTCCAGGACCAAGTTCAGGCTCTGGAAGCCCTCGTCCTCCGATCCTTCAAGGAGTTTCTCATGACGGAGGAG
AAGCGATCCGAGGCCGGGATCGAGGCCGGATCGGGAGACAAGAAAAAGGAGTTGACCATCATGGGCGGGACCAAC
TTTGACGACGTGGCGAGCGCAACGACGCAGCGCTTCCTCAAGGATATGACGCGGATAGCGCTCGGGAGCCAGGAC
GAGCACGCCTTTCTAGCCATGGAGGTGCTGAGCAGCATCAACCGACAGGGGCTGACGCACCCCAAGGAGACGGGA
CTGACGCTGATGACGCTCGAGACCTCTGCCAACCGAAAGATCGCCGAGCTCGCGTACATGGAGCACCGGGCGCTG
CACGAGAAGCACGAGACGGTGCTGGAGAGGGAATACATCAAGGCTGTACAGTCGGCGTACGGCTACCAGCGAGAC
GTAGTCCAGGACTGCCGGGGGGCGACCAAGGAGCCGCTACAGTCGAAGCTGCATCTGCTGATGGAGGTTCTCAAG
ATTAGCAAGATGAAGAACCGGCAGCGCTTCCTGGAGAAGCTCTGCGGACAAATCGACTTTGATCTGGCCAGGTTG
GAAGAGATGACTGCTGGAGGATTGCCGGAACACGTGGGCTTTTCCAGGTTCGTGATCGAGAGCGTGGCCTTTATC
GAGTTCCAGACGGTAGGCGAGGTGCAGACGACGGTCAACGCCCTGGAGAAGATTGCGGCCGGCACAGGGGCTACG
GTGGCACAGGCCATAGAGTCGGAAGTCTTCAACCTACGAATGGACGCGGACGAAGCGGCGAACGAGACCATGGTG
ACGACGACAGAGGCGACGATACGGCCCAAGGTCGAGCCGAGGCGACTGAGACAGCTTGCGGCTGCTTCGGTGGTG
CTGCTCTTGGTGTGGGAGACGCGGACGCACCTACGGAAGCTGTATGGCATGGGAACGCATCGACACGACAGCAAG
GCCAAGGCTTTGGCCAAGGACCTGAACAAGACGCCGACCAAGGTGCAGGGCGTGCACGGAGAGCGGCTCTGGGAC
GAGCTGACGAACCACATGGGCGGTCTGGACAGCGAGGAGCGGATGGCGACCAAGTGCCGCGAGCTGGTGGAGCTG
ATGACGGTCGACAAGGAGTTCCAGGTGGCGGATAAGGACTCGGGCGACGACGACATGGCGGCAGACGGACCGGCG
ACGCCGAGCGACGGAGACGACGGAGAAGAGGCTCCGGAGCGGGGCCGGAAGCGGAAAGGGGCGGCGACGCCGGGA
GGCCGTAAGAAGAGGGCGAGATCGGGCTCACAGCCGAGGAAACGGGGCCGTCCACGGAAGCAGAGCGAGGAGGCC
GACATGGACGGGGACTGGATTTAG
Transcript >Ophcf2|02766
ATGCTGCCGCGCGCATCCAACGGGCCCGAGAATGGGGTCCACGCGCTTCAGGCTCCCTCACAACCTCATCCCGCC
ATCTCGCGACCCTTTACGCTGCAAGAGTCGCTGCCTTACTCGCCGCAGACGTCGATGACACCCCTTCTTCCTGAT
GTCATTCCCGATCCGACCTTGGGATCCGGTTCGCCCGCTCTGCCCATCTCGGGCCTCTTCCCACGAGACGAGTTC
GACAGGGTCAACGCCGAGGCCCTGAATCACCCGCAAGGTTCGAGGACCTTGAAGCAGGCTGCAGACTATGTGCTG
CACGACCTGAAGCCGTCACAAAGAACTCAATACAAATTCTCGGCCGTACCCTCCGGGCCCCCTGGCATGACCCCC
GGGAAAAGCCTTTCTCAGGGTCTCTCGCCCATGACCAGAAACGTATACGACCGAGTGGGCAGTTTCTTCAAGTCG
ACCAAAGCCAATGTTACAGGTCCCAAGACGAATGGCGACTCCCATGAGCCGCTGAAATCAGTTAAACAATCTCCA
TCGCTCGGCTCCAAAGCTCCTCCAAATGTGCAAAACAGACGATCAGAGAAACCTGAGTCACATAGATCCCCCTCC
TTTAGGATAGAGGTGGCTATCCCTGCGAAAAAGGCCTTTGATCCGAGTTCTTATATCGAAGTTGCGAGCTCCGCC
CAACCGGACCCGATTCCGCGGTCGGTGTCTCAGGAGCTTCCAGCGAAAGCCAAGCCTTCTGCTTCCAACAACGGC
CTCACAACCTTCAAAGAGTCATCCCCTGCGGGCGGAAAGAACTTGGCCTTTAGCATAGAGCTGCCCAAGGCCAAC
ATCAAGAAGGAAGAGTATGTCGAGGTTTGTGAGGTGCCGTACGCTCCCACAAGCCTCTCGACCCGGCGACCGGAA
GCACAGGACGTCAATCCTAACCAGGGCGTTACCGTCACCAGCCTTGATCAGCGACAGAGGAGCGAGGTGGCCCTG
GAGGCCTTTGACGCGCTTTTTCGATCCATCAGTGGTGCGGTGGGAAGCGCTTACGCCATGGAACCAGGGACGGAG
CACATCGTAACCATGACGGCGGACCAGGAGCCCGTCATGACCTCGGCCACGCAGCAAAAGCTGCACGGCGCCATT
CAAAAGATTATTGATCTGAGGTGCTTCGATAGTGTAGCTCTGGAGACCTTGCTGCACATCGTCAAGCTGTGCGAA
CCAACGCTGAGACAAGTTGAAAGTCTGGAGTTTCGCGTCGACGAGAGCTGGGATGAAGGGGCCGTCGAGTCTTGG
GTCCAGCAGCTATCTGAGCTGGAAACGGCGTTGAAAGCTGCGCGCACTTGCTTGCGCTTGCTCTCCGGAGGTCGC
GAAGACAAGCAACTGTATTCGGAGTCGACTATTCAACGGTGCGTTGACCTCTTCAAGTCAGTCACCGAAGACTTG
GTCATACCCTTGGTCGAGCTGCGACCGTCTTCGAGCCTTTTCAAGTCGGTACAGAAACACAAAAAGGCCGTCTCG
TCGACCTTTGTCTGTTGCCAGAAGCTGTTTGCTCTGCTTGCGGAGCTCGTGACCAAGATCGAGCTCTCCGAGTCA
GTTATCAACACCCTCGAGTACACGTCATCCAAACTCATCTTCGTGGAGAATGCATACTTTGAGAAGGACTCTGCC
ATCGGTCCTCAGAGGTTTGACGGTATCCGGTCCGTTGCCATGGATATGCTCTGCCAAATATTTCTCATCAAGCCT
GAGCAGAGGCAGGGCATCATCGACGACATACTCACCTCGCTCGAAAAGCTCCCCGTCGGAAAGCAGAGCTCGAGA
CAGTTCAAGCTCTCCGACGGCGGAAGCATCCAGCCCGTCTCGGCTCTCATAATGCGTCTGGTTCAGGCAAGCTCC
GGAAGGGTCAACGTCGACCACGGAAGCGGGCGGGCTGCTATCCTTCAGCGCATCAATGGGACAGACGCGGGCGAA
GGGGAAGCGCCAACCGCGTCCAAGAAGAGCCAGTCTCCGTGGACGGTGACGACGGAATCACATGGTGCCCAGCAA
CACGCTGTGGCCATGCAAGAGCTGGGAGCAAGCGCAGCGCCCCTTGCCGAGGCAGCGAGTCGGAACGCATCCTAC
GTCATCAACTTCATCGTCAAGCGAGCCATCGGCTCTACCAAGACCGGGGATACGCCGTACCGAAACCTGCTGGAT
CTGTTCGTGGACGACTTTACAACCTGCCTCGATTCGCCGGACTGGCCGTCGGCGGAGCTCCTGCTTCGACTCTTG
ATGTTCATGATGGTGCAGCTGTTCGAGGCCGGAAAGACGGCCGCTCCCGCGAAGAACATGGCACTGGAGTTGCTC
GGCTCTATGAGCGCCGCAATCTCGCGTCTGCGATCGCACGTGAAGAAGACGGCGGGATCTTTCGAGGGAAGCGAC
ACCAGTGAGCTATCGCAGTACCTCTCGGAGCTGGCCTTGCTCGTTCTCGAGCACAAGAGCCAGGTCGAGCACATC
AGCACGTGGACGGGGCCCTACAGAGTGTCCCTGGAATACGTTCAGGACCGTTGCGCTGAGGATCCTCATCTGGCG
GCGGCGGCGTCGTACATGGTGACGAACTGGGCAAATAAGCTCCATATCGCCTATGATAATGCCCAGGAGAGCGAC
GACGAACGGGATCGGGAGTTTGGTCGCATGGCTTACCGGCTGCGGATGATGATTGAGGATCGGAAATGGCTGTCT
GGTCAGTACACGTTCAAAGCCGTGTCAGCGAGTCAGGCCAGGTTCGCATACTCCATCATGCTCCTACAGTCTCCC
CTCTTCGAGGCCTTTGGCAAGATTGTCAACATCCTGTTGGGTTCTATGGCGAGCGATCAGGCGACGGTGCGGAGC
AAGAGTCTGAAGAGCATTCATCAAGTGCTGGAGACGGATCCGTCCATTCTCGACGGCGACTCGACCGTCATACAG
CTGATACTCGACTGTGCCAGTGATTCCTCCACGCAGGTGCGAGACTCGGCGCTCGGCCTGCTGGGAAACTGTATA
GGGATGCGTCGGGCTCTCGAATCGTCGCTAACTCCTAGAATCATAGAGAGGTTCCAGGACGCAGGCGTGGGAGTG
AGGAAAAGGGCCATGAAGCTGGCACGCGACATCTACCTCCGCAACCGAAGTAAGACGCTTCGCAGCGCCATCGCC
AACGGACTCCTACGTCGAGTACAGGATCCGGACGAGGGCGTACGCGATCTCTCGAGGCAGATGATCGAGGAGGTC
TGGTTTGCGCCCTTTTACTCAAACGAAAACACGGCCGCGTTCGAGACGTCGCTCGGGGAGCACGTTGCCCTCATC
ATCCAGACGGTCAAGACGGGGACCGTGACCGAGGTTCTCGACAAGGTGTTTCAGACGGTGCTCAGGCCCCAGAAC
AGGTCGCTCGAAGGACCCTTTTCAGTGTGTTCGAGGCTGGTCGGCACCATGTTTGGCATGATCGACAACCCCGAT
TCGGAAGATACCACGGTCCCTTCCGGACGCGACGCTTTGCAGGTTCTCACCATCTTCGCCAAGGCGGACCCCAAG
CTCTTCAACTTTGAACAGATCCGGCTGCTCAAGCCTCAACTGGCGAGCTTCTCTGGCCGCGAGGAGCTGGCAGCC
TTTCGGGCGGTGACGGTGATTTACAAGCGGGTGCTTCCGCAGCTGCCCACGGTACACGCAGAGTTCCTGGCCGAG
GTCCGGCTTCAGCTTCTCAAGGCCATCGGTAAGATCTTCTCGCGCGTCGCTCTCGACGACTTGATTGCCTGTACG
CAAGCCGTCTGCGAGCTGCTCAAGGACTTTGCGCCTCTGGCCAACCTCGTCGCGTCGAGCCTTCTGGGCATCCAG
AAGCTGGGCAAGGGTAGGCTGGACAAGAGAGGACTCGGGCAGCTGTGCGCCTACGCCATCATCGTGGGGAGCGTC
GGCAAGCACTCGGACCTGGATCAACAGCTTCAGGTCTTTCGGGATCGGTTTCCTCAGTGGAAGGGAGACTCTGTC
CCTCGTCTCATCGTCGACATGCTCGCGCCATTTGCCTCGCCCACGCAGACGCTGGAGGCTCGCAAGGCGGCCATC
GAGGCCATCGGGCTGGTGTGTCAGTCGTGGCCTCGCAACTACGTCCTGGCCAAGGTCTATACCGCCTTTCAGCAG
GTATTCCAGGACCAAGTTCAGGCTCTGGAAGCCCTCGTCCTCCGATCCTTCAAGGAGTTTCTCATGACGGAGGAG
AAGCGATCCGAGGCCGGGATCGAGGCCGGATCGGGAGACAAGAAAAAGGAGTTGACCATCATGGGCGGGACCAAC
TTTGACGACGTGGCGAGCGCAACGACGCAGCGCTTCCTCAAGGATATGACGCGGATAGCGCTCGGGAGCCAGGAC
GAGCACGCCTTTCTAGCCATGGAGGTGCTGAGCAGCATCAACCGACAGGGGCTGACGCACCCCAAGGAGACGGGA
CTGACGCTGATGACGCTCGAGACCTCTGCCAACCGAAAGATCGCCGAGCTCGCGTACATGGAGCACCGGGCGCTG
CACGAGAAGCACGAGACGGTGCTGGAGAGGGAATACATCAAGGCTGTACAGTCGGCGTACGGCTACCAGCGAGAC
GTAGTCCAGGACTGCCGGGGGGCGACCAAGGAGCCGCTACAGTCGAAGCTGCATCTGCTGATGGAGGTTCTCAAG
ATTAGCAAGATGAAGAACCGGCAGCGCTTCCTGGAGAAGCTCTGCGGACAAATCGACTTTGATCTGGCCAGGTTG
GAAGAGATGACTGCTGGAGGATTGCCGGAACACGTGGGCTTTTCCAGGTTCGTGATCGAGAGCGTGGCCTTTATC
GAGTTCCAGACGGTAGGCGAGGTGCAGACGACGGTCAACGCCCTGGAGAAGATTGCGGCCGGCACAGGGGCTACG
GTGGCACAGGCCATAGAGTCGGAAGTCTTCAACCTACGAATGGACGCGGACGAAGCGGCGAACGAGACCATGGTG
ACGACGACAGAGGCGACGATACGGCCCAAGGTCGAGCCGAGGCGACTGAGACAGCTTGCGGCTGCTTCGGTGGTG
CTGCTCTTGGTGTGGGAGACGCGGACGCACCTACGGAAGCTGTATGGCATGGGAACGCATCGACACGACAGCAAG
GCCAAGGCTTTGGCCAAGGACCTGAACAAGACGCCGACCAAGGTGCAGGGCGTGCACGGAGAGCGGCTCTGGGAC
GAGCTGACGAACCACATGGGCGGTCTGGACAGCGAGGAGCGGATGGCGACCAAGTGCCGCGAGCTGGTGGAGCTG
ATGACGGTCGACAAGGAGTTCCAGGTGGCGGATAAGGACTCGGGCGACGACGACATGGCGGCAGACGGACCGGCG
ACGCCGAGCGACGGAGACGACGGAGAAGAGGCTCCGGAGCGGGGCCGGAAGCGGAAAGGGGCGGCGACGCCGGGA
GGCCGTAAGAAGAGGGCGAGATCGGGCTCACAGCCGAGGAAACGGGGCCGTCCACGGAAGCAGAGCGAGGAGGCC
GACATGGACGGGGACTGGATTTAG
Gene >Ophcf2|02766
ATGCTGCCGCGCGCATCCAACGGGCCCGAGAATGGGGTCCACGCGCTTCAGGCTCCCTCACAACCTCATCCCGCC
ATCTCGCGACCCTTTACGCTGCAAGAGTCGCTGCCTTACTCGCCGCAGACGTCGATGACACCCCTTCTTCCTGGT
CAGTGGCCTCGAGATCAGATCAGACTAAAGTTCGTACTGACACTGCTGCCCAGATGTCATTCCCGATCCGACCTT
GGGATCCGGTTCGCCCGCTCTGCCCATCTCGGGCCTCTTCCCACGAGACGAGTTCGACAGGGTCAACGCCGAGGC
CCTGAATCACCCGCAAGGTTCGAGGACCTTGAAGCAGGCTGCAGACTATGTGCTGCACGACCTGAAGCCGTCACA
AAGAACTCAATAGTTGGTCTCATCTTCACCTCCGTGGCCATTCGTATCGACTGACCGTCTGACAGCAAATTCTCG
GCCGTACCCTCCGGGCCCCCTGGCATGACCCCCGGGAAAAGCCTTTCTCAGGGTCTCTCGCCCATGACCAGAAAC
GTATACGACCGAGTGGGCAGTTTCTTCAAGTCGACCAAAGCCAATGTTACAGGTCCCAAGACGAATGGCGACTCC
CATGAGCCGCTGAAATCAGTTAAACAATCTCCATCGCTCGGCTCCAAAGCTCCTCCAAATGTGCAAAACAGACGA
TCAGAGAAACCTGAGTCACATAGATCCCCCTCCTTTAGGATAGAGGTGGCTATCCCTGCGAAAAAGGCCTTTGAT
CCGAGTTCTTATATCGAAGTTGCGAGCTCCGCCCAACCGGACCCGATTCCGCGGTCGGTGTCTCAGGAGCTTCCA
GCGAAAGCCAAGCCTTCTGCTTCCAACAACGGCCTCACAACCTTCAAAGAGTCATCCCCTGCGGGCGGAAAGAAC
TTGGCCTTTAGCATAGAGCTGCCCAAGGCCAACATCAAGAAGGAAGAGTATGTCGAGGTTTGTGAGGTGCCGTAC
GCTCCCACAAGCCTCTCGACCCGGCGACCGGAAGCACAGGACGTCAATCCTAACCAGGGCGTTACCGTCACCAGC
CTTGATCAGCGACAGAGGAGCGAGGTGGCCCTGGAGGCCTTTGACGCGCTTTTTCGATCCATCAGTGGTGCGGTG
GGAAGCGCTTACGCCATGGAACCAGGGACGGAGCACATCGTAACCATGACGGCGGACCAGGAGCCCGTCATGACC
TCGGCCACGCAGCAAAAGCTGCACGGCGCCATTCAAAAGATTATTGATCTGAGGTGCTTCGATAGTGTAGCTCTG
GAGACCTTGCTGCACATCGTCAAGCTGTGCGAACCAACGCTGAGACAAGTTGAAAGTCTGGAGTTTCGCGTCGAC
GAGAGCTGGGATGAAGGGGCCGTCGAGTCTTGGGTCCAGCAGCTATCTGAGCTGGAAACGGCGTTGAAAGCTGCG
CGCACTTGCTTGCGCTTGCTCTCCGGAGGTCGCGAAGACAAGCAACTGTATTCGGAGTCGACTATTCAACGGTGC
GTTGACCTCTTCAAGTCAGTCACCGAAGACTTGGTCATACCCTTGGTCGAGCTGCGACCGTCTTCGAGCCTTTTC
AAGTCGGTACAGAAACACAAAAAGGCCGTCTCGTCGACCTTTGTCTGTTGCCAGAAGCTGTTTGCTCTGCTTGCG
GAGCTCGTGACCAAGATCGAGCTCTCCGAGTCAGTTATCAACACCCTCGAGTACACGTCATCCAAACTCATCTTC
GTGGAGAATGCATACTTTGAGAAGGACTCTGCCATCGGTCCTCAGAGGTTTGACGGTATCCGGTCCGTTGCCATG
GATATGCTCTGCCAAATATTTCTCATCAAGCCTGAGCAGAGGCAGGGCATCATCGACGACATACTCACCTCGCTC
GAAAAGCTCCCCGTCGGAAAGCAGAGCTCGAGACAGTTCAAGCTCTCCGACGGCGGAAGCATCCAGCCCGTCTCG
GCTCTCATAATGCGTCTGGTTCAGGCAAGCTCCGGAAGGGTCAACGTCGACCACGGAAGCGGGCGGGCTGCTATC
CTTCAGCGCATCAATGGGACAGACGCGGGCGAAGGGGAAGCGCCAACCGCGTCCAAGAAGAGCCAGTCTCCGTGG
ACGGTGACGACGGAATCACATGGTGCCCAGCAACACGCTGTGGCCATGCAAGAGCTGGGAGCAAGCGCAGCGCCC
CTTGCCGAGGCAGCGAGTCGGAACGCATCCTACGTCATCAACTTCATCGTCAAGCGAGCCATCGGCTCTACCAAG
ACCGGGGATACGCCGTACCGAAACCTGCTGGATCTGTTCGTGGACGACTTTACAACCTGCCTCGATTCGCCGGAC
TGGCCGTCGGCGGAGCTCCTGCTTCGACTCTTGATGTTCATGATGGTGCAGCTGTTCGAGGCCGGAAAGACGGCC
GCTCCCGCGAAGAACATGGCACTGGAGTTGCTCGGCTCTATGAGCGCCGCAATCTCGCGTCTGCGATCGCACGTG
AAGAAGACGGCGGGATCTTTCGAGGGAAGCGACACCAGTGAGCTATCGCAGTACCTCTCGGAGCTGGCCTTGCTC
GTTCTCGAGCACAAGAGCCAGGTCGAGCACATCAGCACGTGGACGGGGCCCTACAGAGTGTCCCTGGAATACGTT
CAGGACCGTTGCGCTGAGGATCCTCATCTGGCGGCGGCGGCGTCGTACATGGTGACGAACTGGGCAAATAAGCTC
CATATCGCCTATGATAATGCCCAGGAGAGCGACGACGAACGGGATCGGGAGTTTGGTCGCATGGCTTACCGGCTG
CGGATGATGATTGAGGATCGGAAATGGCTGTCTGGTCAGTACACGTTCAAAGCCGTGTCAGCGAGTCAGGCCAGG
TTCGCATACTCCATCATGCTCCTACAGTCTCCCCTCTTCGAGGCCTTTGGCAAGATTGTCAACATCCTGTTGGGT
TCTATGGCGAGCGATCAGGCGACGGTGCGGAGCAAGAGTCTGAAGAGCATTCATCAAGTGCTGGAGACGGATCCG
TCCATTCTCGACGGCGACTCGACCGTCATACAGCTGATACTCGACTGTGCCAGTGATTCCTCCACGCAGGTGCGA
GACTCGGCGCTCGGCCTGCTGGGAAACTGTATAGGGATGCGTCGGGCTCTCGAATCGTCGCTAACTCCTAGAATC
ATAGAGAGGTTCCAGGACGCAGGCGTGGGAGTGAGGAAAAGGGCCATGAAGCTGGCACGCGACATCTACCTCCGC
AACCGAAGTAAGACGCTTCGCAGCGCCATCGCCAACGGACTCCTACGTCGAGTACAGGATCCGGACGAGGGCGTA
CGCGATCTCTCGAGGCAGATGATCGAGGAGGTCTGGTTTGCGCCCTTTTACTCAAACGAAAACACGGCCGCGTTC
GAGACGTCGCTCGGGGAGCACGTTGCCCTCATCATCCAGACGGTCAAGACGGGGACCGTGACCGAGGTTCTCGAC
AAGGTGTTTCAGACGGTGCTCAGGCCCCAGAACAGGTCGCTCGAAGGACCCTTTTCAGTGTGTTCGAGGCTGGTC
GGCACCATGTTTGGCATGATCGACAACCCCGATTCGGAAGATACCACGGTCCCTTCCGGACGCGACGCTTTGCAG
GTTCTCACCATCTTCGCCAAGGCGGACCCCAAGCTCTTCAACTTTGAACAGATCCGGCTGCTCAAGCCTCAACTG
GCGAGCTTCTCTGGCCGCGAGGAGCTGGCAGCCTTTCGGGCGGTGACGGTGATTTACAAGCGGGTGCTTCCGCAG
CTGCCCACGGTACACGCAGAGTTCCTGGCCGAGGTCCGGCTTCAGCTTCTCAAGGCCATCGGTAAGATCTTCTCG
CGCGTCGCTCTCGACGACTTGATTGCCTGTACGCAAGCCGTCTGCGAGCTGCTCAAGGACTTTGCGCCTCTGGCC
AACCTCGTCGCGTCGAGCCTTCTGGGCATCCAGAAGCTGGGCAAGGGTAGGCTGGACAAGAGAGGACTCGGGCAG
CTGTGCGCCTACGCCATCATCGTGGGGAGCGTCGGCAAGCACTCGGACCTGGATCAACAGCTTCAGGTCTTTCGG
GATCGGTTTCCTCAGTGGAAGGGAGACTCTGTCCCTCGTCTCATCGTCGACATGCTCGCGCCATTTGCCTCGCCC
ACGCAGACGCTGGAGGCTCGCAAGGCGGCCATCGAGGCCATCGGGCTGGTGTGTCAGTCGTGGCCTCGCAACTAC
GTCCTGGCCAAGGTCTATACCGCCTTTCAGCAGGTATTCCAGGACCAAGTTCAGGCTCTGGAAGCCCTCGTCCTC
CGATCCTTCAAGGAGTTTCTCATGACGGAGGAGAAGCGATCCGAGGCCGGGATCGAGGCCGGATCGGGAGACAAG
AAAAAGGAGTTGACCATCATGGGCGGGACCAACTTTGACGACGTGGCGAGCGCAACGACGCAGCGCTTCCTCAAG
GATATGACGCGGATAGCGCTCGGGAGCCAGGACGAGCACGCCTTTCTAGCCATGGAGGTGCTGAGCAGCATCAAC
CGACAGGGGCTGACGCACCCCAAGGAGACGGGACTGACGCTGATGACGCTCGAGACCTCTGCCAACCGAAAGATC
GCCGAGCTCGCGTACATGGAGCACCGGGCGCTGCACGAGAAGCACGAGACGGTGCTGGAGAGGGAATACATCAAG
GCTGTACAGTCGGCGTACGGCTACCAGCGAGACGTAGTCCAGGACTGCCGGGGGGCGACCAAGGAGCCGCTACAG
TCGAAGCTGCATCTGCTGATGGAGGTTCTCAAGATTAGCAAGATGAAGAACCGGCAGCGCTTCCTGGAGAAGCTC
TGCGGACAAATCGACTTTGATCTGGCCAGGTTGGAAGAGATGACTGCTGGAGGATTGCCGGAACACGTGGGCTTT
TCCAGGTTCGTGATCGAGAGCGTGGCCTTTATCGAGTTCCAGACGGTAGGCGAGGTGCAGACGACGGTCAACGCC
CTGGAGAAGATTGCGGCCGGCACAGGGGCTACGGTGGCACAGGCCATAGAGTCGGAAGTCTTCAACCTACGAATG
GACGCGGACGAAGCGGCGAACGAGACCATGGTGACGACGACAGAGGCGACGATACGGCCCAAGGTCGAGCCGAGG
CGACTGAGACAGCTTGCGGCTGCTTCGGTGGTGCTGCTCTTGGTGTGGGAGACGCGGACGCACCTACGGAAGCTG
TATGGCATGGGAACGCATCGACACGACAGCAAGGCCAAGGCTTTGGCCAAGGACCTGAACAAGACGCCGACCAAG
GTGCAGGGCGTGCACGGAGAGCGGCTCTGGGACGAGCTGACGAACCACATGGGCGGTCTGGACAGCGAGGAGCGG
ATGGCGACCAAGTGCCGCGAGCTGGTGGAGCTGATGACGGTCGACAAGGAGTTCCAGGTGGCGGATAAGGACTCG
GGCGACGACGACATGGCGGCAGACGGACCGGCGACGCCGAGCGACGGAGACGACGGAGAAGAGGCTCCGGAGCGG
GGCCGGAAGCGGAAAGGGGCGGCGACGCCGGGAGGCCGTAAGAAGAGGGCGAGATCGGGCTCACAGCCGAGGAAA
CGGGGCCGTCCACGGAAGCAGAGCGAGGAGGCCGACATGGACGGGGACTGGATTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail