Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02758
Gene name
Locationscaffold_02:4623105..4625691
Strand-
Gene length (bp)2586
Transcript length (bp)2181
Coding sequence length (bp)2181
Protein length (aa) 727

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04547 Anoctamin Calcium-activated chloride channel 2.5E-116 164 625

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 176 198 22
2 203 222 19
3 281 303 22
4 313 335 22
5 362 384 22
6 424 446 22
7 502 524 22
8 551 573 22
9 593 615 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02758
MASLTGNLGVDYVILFKVPPQERAEAEAAFVQLVQALARVGLSTTVRRGGDTDSLLVFVRAASPDRLARHVRRSR
MQDWLHGVRTTGPEADASRALDEEPVTEAERLRIVYQLITQPVNEGGAGVGTSSFAKTVFPLRDQAFNRAWIQKW
SKKQFLEQGDIDEIRNKFGESVGLYFAFLRSYSTFIVFPAALGFAAWLLLGQFSYTYALGCGLWSVVFFEYWKKK
EVDLAVQWGVRGVSAIEHQRPGFQWEFETEDPITGEPRKVYPYTKRLRTQLLQIPFALASILVLGGLVVFCNSLE
IFINEVYDGPFKQYLAFVPTIFLVVLTPTFSSVLMRAATVLTDRENYETIDAYNAALVQKQFVLNFFTSYMALLF
TTFVYIPFGETLVPILDIWTRTAQAVASVGGKTLSTQQFHINPQRIASQMFYLTVTAQIVNFATEVIVPYLTHKA
VVKAHELHVRGPAPQEQDDADEAEFLKRVREECHLDDYDVTADYREMVMQYGYLALFSVAWPLAGCCFLVNNIVE
LRSDALKIAISCKRPIPWRADSIGPWLTALGFLSWLGSITSGAIVYLCSHRSQHGPEAAGKSTTTSQLTAWGGLV
SIVLAEHLYLLVQLAVRFVMKKMDSPGLQRERRERYLMKRRLLQESMRGVDDEKPSIEGAEATDRVTRETLEEEA
RKSSIRGQGSVEDIFWQRQRGAQDTIIIGRRLIEQGAAAGEKKPTPSPMAG*
Coding >Ophcf2|02758
ATGGCCAGCCTCACTGGCAACCTGGGCGTCGACTACGTCATCCTCTTCAAGGTGCCGCCACAAGAACGGGCCGAA
GCCGAAGCCGCCTTCGTCCAGCTCGTCCAGGCTCTCGCGCGTGTCGGTCTCAGCACAACGGTCCGTCGAGGCGGC
GATACCGACTCCCTCCTCGTCTTCGTCCGCGCCGCGTCCCCCGACCGTCTCGCCCGTCATGTACGACGCTCCCGG
ATGCAGGATTGGCTCCACGGCGTGCGCACGACCGGACCTGAGGCGGACGCGTCGCGCGCGCTTGACGAGGAGCCC
GTAACGGAGGCGGAGAGGTTGCGAATCGTCTACCAGCTCATTACGCAGCCCGTCAACGAGGGAGGCGCAGGCGTC
GGCACCTCGTCCTTTGCTAAGACGGTGTTTCCCCTCCGGGATCAGGCCTTTAACCGGGCTTGGATCCAGAAATGG
AGCAAGAAGCAGTTTCTTGAGCAGGGTGACATTGACGAGATTCGCAACAAGTTTGGCGAGAGCGTGGGATTGTAC
TTTGCCTTTTTGCGGAGCTACTCGACCTTTATTGTCTTTCCTGCTGCTCTCGGCTTCGCTGCTTGGTTGCTGCTC
GGTCAGTTCTCCTACACGTACGCCCTCGGCTGCGGCCTCTGGTCTGTCGTCTTCTTCGAGTACTGGAAGAAAAAG
GAGGTCGATCTTGCCGTTCAATGGGGAGTTCGCGGCGTGTCCGCCATCGAGCATCAGCGGCCGGGCTTCCAGTGG
GAATTCGAGACGGAGGATCCCATAACGGGCGAGCCTCGAAAGGTCTACCCTTATACCAAGCGACTTCGCACCCAG
CTCCTGCAGATTCCGTTCGCGCTTGCCAGCATCCTCGTTCTCGGCGGCCTTGTCGTCTTTTGCAACTCGCTCGAG
ATATTTATCAATGAGGTCTACGATGGTCCTTTCAAGCAGTACCTGGCATTTGTGCCCACCATCTTTCTCGTCGTC
TTGACGCCGACATTTTCTTCTGTGCTCATGCGTGCTGCTACCGTGCTTACTGACAGGGAGAACTACGAGACGATA
GATGCGTACAACGCGGCCCTCGTGCAGAAACAGTTTGTGCTCAACTTCTTCACCTCCTACATGGCTCTCCTCTTC
ACCACCTTTGTCTACATTCCCTTTGGCGAGACGCTCGTCCCCATACTCGATATATGGACCAGGACGGCCCAGGCG
GTCGCCAGCGTGGGCGGCAAGACTCTGTCAACGCAGCAGTTTCACATCAATCCTCAGCGCATAGCCAGTCAGATG
TTTTACCTGACGGTGACGGCGCAGATTGTCAACTTTGCCACCGAAGTCATCGTGCCTTATCTGACGCACAAGGCC
GTCGTCAAGGCGCACGAGCTCCATGTGCGGGGACCGGCGCCACAAGAGCAGGACGACGCCGACGAGGCCGAGTTT
CTCAAGCGGGTGCGGGAGGAGTGCCACCTCGATGACTATGACGTAACGGCGGATTATAGGGAGATGGTGATGCAA
TACGGCTACCTTGCCCTCTTCTCCGTGGCTTGGCCACTTGCGGGCTGTTGCTTCCTCGTGAATAATATCGTCGAG
CTGAGGTCGGATGCGTTGAAGATTGCCATCAGCTGCAAGCGGCCGATCCCGTGGCGAGCCGATTCCATCGGGCCG
TGGCTTACGGCTCTCGGATTCCTCTCGTGGCTGGGCAGCATCACGAGCGGCGCCATCGTCTACCTCTGCAGTCAT
CGGTCGCAGCATGGGCCTGAGGCGGCGGGAAAGTCGACGACGACGTCCCAGCTGACAGCATGGGGAGGCCTCGTC
AGCATCGTGCTGGCCGAGCATCTTTACCTACTCGTCCAGCTGGCGGTGCGATTCGTCATGAAAAAGATGGACAGT
CCCGGCTTGCAGCGGGAGCGCAGGGAGCGATACCTGATGAAGAGGAGGTTGCTGCAGGAGAGCATGCGAGGCGTC
GACGACGAGAAGCCGTCGATAGAGGGGGCTGAGGCGACGGACAGGGTGACGCGGGAGACGCTGGAGGAGGAGGCA
CGCAAGTCATCCATTCGCGGGCAAGGCTCCGTTGAAGACATTTTCTGGCAACGGCAGCGCGGCGCCCAGGATACC
ATTATCATTGGACGACGGTTGATTGAACAGGGGGCGGCGGCTGGAGAGAAGAAGCCGACGCCAAGCCCCATGGCG
GGATGA
Transcript >Ophcf2|02758
ATGGCCAGCCTCACTGGCAACCTGGGCGTCGACTACGTCATCCTCTTCAAGGTGCCGCCACAAGAACGGGCCGAA
GCCGAAGCCGCCTTCGTCCAGCTCGTCCAGGCTCTCGCGCGTGTCGGTCTCAGCACAACGGTCCGTCGAGGCGGC
GATACCGACTCCCTCCTCGTCTTCGTCCGCGCCGCGTCCCCCGACCGTCTCGCCCGTCATGTACGACGCTCCCGG
ATGCAGGATTGGCTCCACGGCGTGCGCACGACCGGACCTGAGGCGGACGCGTCGCGCGCGCTTGACGAGGAGCCC
GTAACGGAGGCGGAGAGGTTGCGAATCGTCTACCAGCTCATTACGCAGCCCGTCAACGAGGGAGGCGCAGGCGTC
GGCACCTCGTCCTTTGCTAAGACGGTGTTTCCCCTCCGGGATCAGGCCTTTAACCGGGCTTGGATCCAGAAATGG
AGCAAGAAGCAGTTTCTTGAGCAGGGTGACATTGACGAGATTCGCAACAAGTTTGGCGAGAGCGTGGGATTGTAC
TTTGCCTTTTTGCGGAGCTACTCGACCTTTATTGTCTTTCCTGCTGCTCTCGGCTTCGCTGCTTGGTTGCTGCTC
GGTCAGTTCTCCTACACGTACGCCCTCGGCTGCGGCCTCTGGTCTGTCGTCTTCTTCGAGTACTGGAAGAAAAAG
GAGGTCGATCTTGCCGTTCAATGGGGAGTTCGCGGCGTGTCCGCCATCGAGCATCAGCGGCCGGGCTTCCAGTGG
GAATTCGAGACGGAGGATCCCATAACGGGCGAGCCTCGAAAGGTCTACCCTTATACCAAGCGACTTCGCACCCAG
CTCCTGCAGATTCCGTTCGCGCTTGCCAGCATCCTCGTTCTCGGCGGCCTTGTCGTCTTTTGCAACTCGCTCGAG
ATATTTATCAATGAGGTCTACGATGGTCCTTTCAAGCAGTACCTGGCATTTGTGCCCACCATCTTTCTCGTCGTC
TTGACGCCGACATTTTCTTCTGTGCTCATGCGTGCTGCTACCGTGCTTACTGACAGGGAGAACTACGAGACGATA
GATGCGTACAACGCGGCCCTCGTGCAGAAACAGTTTGTGCTCAACTTCTTCACCTCCTACATGGCTCTCCTCTTC
ACCACCTTTGTCTACATTCCCTTTGGCGAGACGCTCGTCCCCATACTCGATATATGGACCAGGACGGCCCAGGCG
GTCGCCAGCGTGGGCGGCAAGACTCTGTCAACGCAGCAGTTTCACATCAATCCTCAGCGCATAGCCAGTCAGATG
TTTTACCTGACGGTGACGGCGCAGATTGTCAACTTTGCCACCGAAGTCATCGTGCCTTATCTGACGCACAAGGCC
GTCGTCAAGGCGCACGAGCTCCATGTGCGGGGACCGGCGCCACAAGAGCAGGACGACGCCGACGAGGCCGAGTTT
CTCAAGCGGGTGCGGGAGGAGTGCCACCTCGATGACTATGACGTAACGGCGGATTATAGGGAGATGGTGATGCAA
TACGGCTACCTTGCCCTCTTCTCCGTGGCTTGGCCACTTGCGGGCTGTTGCTTCCTCGTGAATAATATCGTCGAG
CTGAGGTCGGATGCGTTGAAGATTGCCATCAGCTGCAAGCGGCCGATCCCGTGGCGAGCCGATTCCATCGGGCCG
TGGCTTACGGCTCTCGGATTCCTCTCGTGGCTGGGCAGCATCACGAGCGGCGCCATCGTCTACCTCTGCAGTCAT
CGGTCGCAGCATGGGCCTGAGGCGGCGGGAAAGTCGACGACGACGTCCCAGCTGACAGCATGGGGAGGCCTCGTC
AGCATCGTGCTGGCCGAGCATCTTTACCTACTCGTCCAGCTGGCGGTGCGATTCGTCATGAAAAAGATGGACAGT
CCCGGCTTGCAGCGGGAGCGCAGGGAGCGATACCTGATGAAGAGGAGGTTGCTGCAGGAGAGCATGCGAGGCGTC
GACGACGAGAAGCCGTCGATAGAGGGGGCTGAGGCGACGGACAGGGTGACGCGGGAGACGCTGGAGGAGGAGGCA
CGCAAGTCATCCATTCGCGGGCAAGGCTCCGTTGAAGACATTTTCTGGCAACGGCAGCGCGGCGCCCAGGATACC
ATTATCATTGGACGACGGTTGATTGAACAGGGGGCGGCGGCTGGAGAGAAGAAGCCGACGCCAAGCCCCATGGCG
GGATGA
Gene >Ophcf2|02758
ATGGCCAGCCTCACTGGCAACCTGGGGTGAGCCACCGTCTCTTAACTCAGTGTGTCGAAAAACGTCCGTGGCTGA
CAATGGGCCCTCGCAGCGTCGACTACGTCATCCTCTTCAAGGTGCCGCCACAAGGTTGCTCCGCCATTTTGACCT
CCTACCAACCTACCTACCTACCTACCTACCTACCTACCTACCTCAACGGGCCTCGACTGACGCCTCAGCAGAACG
GGCCGAAGCCGAAGCCGCCTTCGTCCAGCTCGTCCAGGCTCTCGCGCGTGTCGGTCTCAGCACAACGGTCCGTCG
AGGCGGCGATACCGACTCCCTCCTCGTCTTCGTCCGCGCCGCGTCCCCCGACCGTCTCGCCCGTCATGTACGACG
CTCCCGGATGCAGGATTGGCTCCACGGCGTGCGCACGACCGGACCTGAGGCGGACGCGTCGCGCGCGCTTGACGA
GGAGCCCGTAACGGAGGCGGAGAGGTTGCGAATCGTCTACCAGCTCATTACGCAGCCCGTCAACGAGGGAGGCGC
AGGCGTCGGCACCTCGTCCTTTGCTAAGACGGTGTTTCCCCTCCGGGATCAGGCCTTTAACCGGGCTTGGATCCA
GAAATGGAGCAAGAAGCAGTTTCTTGAGCAGGGTGACATTGACGAGATTCGCAACAAGTTTGGCGAGAGCGTGGG
ATTGTACTTTGCCTTTTTGCGGAGCTACTCGACCTTTATTGTCTTTCCTGCTGCTCTCGGCTTCGCTGCTTGGTT
GCTGCTCGGTCAGTTCTCCTACACGTACGCCCTCGGCTGCGGCCTCTGGTCTGTCGTCTTCTTCGAGTACTGGAA
GAAAAAGGAGGTCGATCTTGCCGTTCAATGGGGAGTTCGCGGCGTGTCCGCCATCGAGCATCAGCGGCCGGGCTT
CCAGTGGGAATTCGAGACGGAGGATCCCATAACGGGCGAGCCTCGAAAGGTCTACCCTTATACCAAGCGACTTCG
CACCCAGCTCCTGCAGATTCCGTTCGCGCTTGCCAGCATCCTCGTTCTCGGCGGCCTTGTCGTCTTTTGCAACTC
GCTCGAGATATTTATCAATGAGGTCTACGATGGTCCTTTCAAGCAGTACCTGGCATTTGTGCCCACCATCTTTCT
CGTCGTCTTGACGCCGACATTTTCTTCTGTGCTCATGCGTGCTGCTACCGTGCTTACTGACAGGGAGAACTACGA
GACGATAGATGGTGATCCCCTTCTCTTCCCACCAGTTGATCAGCGTTGACTGATACTCGTTCAGCGTACAACGCG
GCCCTCGTGCAGAAACAGTTTGTGCTCAACTTCTTCACCTCCTACATGGCTCTCCTCTTCACCACCTTTGTCTAC
ATTCCCTTTGGCGAGACGCTCGTCCCCATACTCGATATATGGACCAGGACGGCCCAGGCGGTCGCCAGCGTGGGC
GGCAAGACTCTGTCAACGCAGCAGTTTCACATCAATCCTCAGCGCATAGCCAGTCAGATGTTTTACCTGACGGTG
ACGGCGCAGATTGTCAACTTTGCCACCGAAGTCATCGTGCCTTATCTGACGCACAAGGCCGTCGTCAAGGCGCAC
GAGCTCCATGTGCGGGGACCGGCGCCACAAGAGCAGGACGACGCCGACGAGGCCGAGTTTCTCAAGCGGGTGCGG
GAGGAGTGCCACCTCGATGACTATGACGTAACGGCGGATTATAGGGAGATGGTGATGCAATACGGTACGTGTCGC
GACGCCCATGGCCTCGCCGTCGGCTTCTTTGCTTACGACGCTCAGGCTACCTTGCCCTCTTCTCCGTGGCTTGGC
CACTTGCGGGCTGTTGCTTCCTCGTGAATAATATCGTCGAGCTGAGGTCGGATGCGTTGAAGATTGCCATCAGCT
GCAAGCGGCCGATCCCGTGGCGAGCCGATTCCATCGGGCCGTGGCTTACGGCTCTCGGATTCCTCTCGTGGCTGG
GCAGCATCACGAGCGGCGCCATCGTCTACCTCTGCAGTCATCGGTCGCAGCATGGGCCTGAGGCGGCGGGAAAGT
CGACGACGACGTCCCAGCTGACAGCATGGGGAGGCCTCGTCAGCATCGTGCTGGCCGAGCATCTTTACCTACTCG
TCCAGCTGGCGGTGCGATTCGTCATGAAAAAGATGGACAGTCCCGGCTTGCAGCGGGAGCGCAGGGAGCGATACC
TGATGAAGAGGAGGTTGCTGCAGGAGAGCATGCGAGGCGTCGACGACGAGAAGCCGTCGATAGAGGGGGCTGAGG
CGACGGACAGGGTGACGCGGGAGACGCTGGAGGAGGAGGCACGCAAGTCATCCATTCGCGGGCAAGGCTCCGTTG
AAGACATGTGGGTGATTTGCAGCGTGCTTAGAGCCGGGCCGAGACTGACGTCGGCCTTTTTTAGTTTCTGGCAAC
GGCAGCGCGGCGCCCAGGATACCATTATCATTGGACGACGGTTGATTGAACAGGTACGTCATCTCCCGCAACTTC
TGCATGGCTTCGGTGAGAGGGCAATGGAAAGTAGCTGCTGACGAGGGAGTCGGAAAACAGGGGGCGGCGGCTGGA
GAGAAGAAGCCGACGCCAAGCCCCATGGCGGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail