Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02747
Gene name
Locationscaffold_02:4595770..4597905
Strand+
Gene length (bp)2135
Transcript length (bp)1578
Coding sequence length (bp)1578
Protein length (aa) 526

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00732 GMC_oxred_N GMC oxidoreductase 2.8E-36 35 316
PF05199 GMC_oxred_C GMC oxidoreductase 1.1E-09 426 509
PF00890 FAD_binding_2 FAD binding domain 1.0E-04 38 67

GO

GO Term Description Terminal node
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:1901265 nucleoside phosphate binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1318 0.0452 0.9271 0.0484 0.1157 0.0773 0.238 0.4403 0.1431 0.0127

SignalP

SignalP signal predicted Location Score
Yes 1 - 15 0.999108

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA3_2 1.3E-113 34 510

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup151
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|207
Ophiocordyceps australis 1348a (Ghana) OphauG2|7328
Ophiocordyceps australis map64 (Brazil) OphauB2|4042
Ophiocordyceps australis map64 (Brazil) OphauB2|4912
Ophiocordyceps camponoti-floridani Ophcf2|01224
Ophiocordyceps camponoti-floridani Ophcf2|02747 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1553
Ophiocordyceps camponoti-rufipedis Ophun1|285
Ophiocordyceps kimflemingae Ophio5|711
Ophiocordyceps kimflemingae Ophio5|937
Ophiocordyceps subramaniannii Hirsu2|10501
Ophiocordyceps subramaniannii Hirsu2|311
Ophiocordyceps subramaniannii Hirsu2|8847

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02747
MMRACLVASLATVVSCSSTTPLPTSALGQAGAATYEYVVVGGGTAGLVIASRLAEAGRSVAVVEAGGFYEVDAGL
SCRVPSYAVVGAGSSPDAVVPAVDWGFVTVPQRGLGGSSARNYFTYNRPTRDSLDKWATLPTTSVPQRLRPHPSP
SSFAPDAGPLHVSFPTWANAFSSWAKLGWRELGFPDARDFVSGELSGVQYCQNTIDPRGQVRDTSFSAFLRTAVG
KGAPVTVYNNTLAKRIVFEAKVARGVLVESGGGLEYVLSAKKEVILSAGVFQSPQLLMVSGVGPPETLTRHKIPI
VASLPGVGRNMQDHIVVGTTYRVKTPTHSSVTNATVLRDSEAEWNATGSGILGNPGGELIAWERLTAESGKFSEG
TGAVLSSVPGDFPTVEYLILDAYSGNNENYVTGAPDTPYMYASPVAAVHVPQSRGSVTISSPDTSIPPVIDPAWL
THAVDRELALYAFRRLRQLMDTRAVKPVWTSEVVPGRNVTSDAEILAVMGRNAIQEFHASYALAEKLSEDILKDL
*
Coding >Ophcf2|02747
ATGATGAGGGCTTGCTTGGTGGCATCACTGGCGACGGTCGTATCATGCAGCAGCACGACGCCACTCCCGACATCG
GCCCTCGGCCAGGCCGGAGCGGCAACATACGAATACGTCGTCGTCGGCGGCGGAACAGCCGGCTTGGTAATCGCC
TCGCGACTGGCCGAAGCGGGACGGAGCGTTGCCGTCGTCGAGGCCGGAGGCTTCTACGAGGTCGACGCGGGACTT
TCGTGCCGGGTTCCGTCGTACGCTGTTGTTGGCGCCGGGTCGAGCCCTGACGCTGTCGTTCCGGCCGTGGATTGG
GGCTTTGTGACGGTGCCGCAGAGGGGGTTGGGGGGGAGTTCCGCTCGCAACTACTTCACCTACAACCGCCCAACC
CGCGACTCCCTCGACAAATGGGCCACCCTCCCAACCACCTCCGTCCCCCAACGCCTCCGTCCCCACCCCTCGCCC
TCATCCTTCGCCCCGGACGCCGGACCCCTGCACGTCTCGTTCCCTACCTGGGCCAACGCCTTCTCCTCGTGGGCC
AAGCTCGGATGGCGGGAGCTGGGCTTCCCCGATGCGAGGGACTTTGTGAGCGGGGAGTTGAGCGGCGTGCAGTAT
TGTCAGAATACTATCGATCCGAGGGGGCAGGTCAGGGATACTTCGTTTTCGGCCTTTTTGAGGACGGCGGTTGGC
AAGGGGGCGCCGGTGACGGTTTATAATAATACTCTTGCCAAGAGGATCGTCTTCGAAGCCAAGGTTGCGAGGGGG
GTCTTGGTCGAGAGTGGTGGTGGGTTGGAGTATGTGCTCTCCGCGAAGAAGGAAGTCATCCTCTCCGCTGGCGTG
TTCCAATCACCGCAACTCCTCATGGTCTCGGGCGTCGGTCCCCCGGAGACACTGACCAGGCACAAGATCCCCATC
GTCGCCTCCCTCCCGGGCGTAGGCCGCAACATGCAAGATCACATCGTCGTCGGCACCACCTACCGAGTCAAGACG
CCGACGCACTCGTCCGTCACCAACGCCACCGTCCTGCGGGACTCGGAGGCCGAGTGGAACGCTACCGGCTCCGGC
ATCCTCGGGAACCCCGGCGGAGAGCTCATCGCCTGGGAGAGACTGACTGCCGAGTCTGGCAAGTTCAGCGAGGGG
ACCGGGGCCGTCTTGTCTTCCGTTCCGGGGGATTTCCCCACGGTCGAGTATCTTATTCTTGATGCTTATAGCGGG
AACAACGAGAATTACGTTACGGGCGCGCCGGATACGCCGTACATGTACGCCTCGCCCGTGGCGGCCGTTCACGTC
CCTCAGAGCAGGGGAAGCGTCACAATCTCCAGCCCCGACACCTCCATCCCCCCGGTCATAGACCCAGCCTGGCTA
ACGCACGCCGTCGACCGCGAACTCGCACTCTACGCCTTCCGCCGCCTCCGCCAACTGATGGACACGCGAGCCGTG
AAGCCCGTCTGGACGAGCGAGGTGGTTCCGGGGAGGAACGTGACGTCGGACGCGGAGATTCTCGCCGTCATGGGT
CGCAACGCCATACAGGAGTTTCACGCTTCGTATGCTTTGGCGGAGAAGTTGAGTGAGGATATTTTGAAAGACTTG
TGA
Transcript >Ophcf2|02747
ATGATGAGGGCTTGCTTGGTGGCATCACTGGCGACGGTCGTATCATGCAGCAGCACGACGCCACTCCCGACATCG
GCCCTCGGCCAGGCCGGAGCGGCAACATACGAATACGTCGTCGTCGGCGGCGGAACAGCCGGCTTGGTAATCGCC
TCGCGACTGGCCGAAGCGGGACGGAGCGTTGCCGTCGTCGAGGCCGGAGGCTTCTACGAGGTCGACGCGGGACTT
TCGTGCCGGGTTCCGTCGTACGCTGTTGTTGGCGCCGGGTCGAGCCCTGACGCTGTCGTTCCGGCCGTGGATTGG
GGCTTTGTGACGGTGCCGCAGAGGGGGTTGGGGGGGAGTTCCGCTCGCAACTACTTCACCTACAACCGCCCAACC
CGCGACTCCCTCGACAAATGGGCCACCCTCCCAACCACCTCCGTCCCCCAACGCCTCCGTCCCCACCCCTCGCCC
TCATCCTTCGCCCCGGACGCCGGACCCCTGCACGTCTCGTTCCCTACCTGGGCCAACGCCTTCTCCTCGTGGGCC
AAGCTCGGATGGCGGGAGCTGGGCTTCCCCGATGCGAGGGACTTTGTGAGCGGGGAGTTGAGCGGCGTGCAGTAT
TGTCAGAATACTATCGATCCGAGGGGGCAGGTCAGGGATACTTCGTTTTCGGCCTTTTTGAGGACGGCGGTTGGC
AAGGGGGCGCCGGTGACGGTTTATAATAATACTCTTGCCAAGAGGATCGTCTTCGAAGCCAAGGTTGCGAGGGGG
GTCTTGGTCGAGAGTGGTGGTGGGTTGGAGTATGTGCTCTCCGCGAAGAAGGAAGTCATCCTCTCCGCTGGCGTG
TTCCAATCACCGCAACTCCTCATGGTCTCGGGCGTCGGTCCCCCGGAGACACTGACCAGGCACAAGATCCCCATC
GTCGCCTCCCTCCCGGGCGTAGGCCGCAACATGCAAGATCACATCGTCGTCGGCACCACCTACCGAGTCAAGACG
CCGACGCACTCGTCCGTCACCAACGCCACCGTCCTGCGGGACTCGGAGGCCGAGTGGAACGCTACCGGCTCCGGC
ATCCTCGGGAACCCCGGCGGAGAGCTCATCGCCTGGGAGAGACTGACTGCCGAGTCTGGCAAGTTCAGCGAGGGG
ACCGGGGCCGTCTTGTCTTCCGTTCCGGGGGATTTCCCCACGGTCGAGTATCTTATTCTTGATGCTTATAGCGGG
AACAACGAGAATTACGTTACGGGCGCGCCGGATACGCCGTACATGTACGCCTCGCCCGTGGCGGCCGTTCACGTC
CCTCAGAGCAGGGGAAGCGTCACAATCTCCAGCCCCGACACCTCCATCCCCCCGGTCATAGACCCAGCCTGGCTA
ACGCACGCCGTCGACCGCGAACTCGCACTCTACGCCTTCCGCCGCCTCCGCCAACTGATGGACACGCGAGCCGTG
AAGCCCGTCTGGACGAGCGAGGTGGTTCCGGGGAGGAACGTGACGTCGGACGCGGAGATTCTCGCCGTCATGGGT
CGCAACGCCATACAGGAGTTTCACGCTTCGTATGCTTTGGCGGAGAAGTTGAGTGAGGATATTTTGAAAGACTTG
TGA
Gene >Ophcf2|02747
ATGATGAGGGCTTGCTTGGTGGCATCACTGGCGACGGTCGTATCATGCAGCAGCACGACGCCACTCCCGACATCG
GCCCTCGGCCAGGCCGGAGCGGCAACATACGAATACGTCGTCGTCGGCGGCGGAACAGCCGGCTTGGTAATCGCC
TCGCGACTGGCCGAAGCGGGACGGAGCGTTGCCGTCGTCGAGGCCGGAGGCTTCTACGAGGTCGACGCGGGACTT
TCGTGCCGGGTTCCGTCGTACGCTGTTGTTGGCGCCGGGTCGAGCCCTGACGCTGTCGTTCCGGCCGTGGATTGG
GGCTTTGTGACGGTGCCGCAGAGGGGGTTGGGGGGGAGGTTAGTTGTGGGACTTTGTTGTGTGCGGGTTGTGTAT
CTTTGCTGGGTTGTTGTGCTGATGGGTTCAACGTAGGAGACTGCATTATGCCAGGGGAAAGACTTTGGGGGGGAG
GTGAGTTTCCGTCCAGTTGTGTATTCTTTGTCTCCCCGTCTCTTTCAATGCTGTTCAATGCTGTTCTCAACTAAC
CTTGCTTGCTATCCCGTTACTCTTCATCAGTTCCGCTCGCAACTACTTCACCTACAACCGCCCAACCCGCGACTC
CCTCGACAAATGGGCCACCCTCGTCAACGACACATCCTACACCTTCCAAAACTACCTCGCCTACTTCAAGAAAAG
CATCCACCACACGAACCCAGCCAACCACCTCCGTCCCCCAACGCCTCCGTCCCCACCCCTCGCCCTCATCCTTCG
CCCCGGACGCCGGACCCCTGCACGTCTCGTTCCCTACCTGGGCCAACGCCTTCTCCTCGTGGGCCAAGCTCGGAT
GGCGGGAGCTGGGCTTCCCCGATGCGAGGGACTTTGTGAGCGGGGAGTTGAGCGGCGTGCAGTATTGTCAGAATA
CTATCGATCCGAGGGGGCAGGTCAGGGATACTTCGTTTTCGGCCTTTTTGAGGACGGCGGTTGGCAAGGGGGCGC
CGGTGACGGTTTATAATAATACTCTTGCCAAGAGGATCGTCTTCGAAGCCAAGGTTGCGAGGGGGGTCTTGGTCG
AGAGTGGTGGTGGGTTGGAGTATGTGCTCTCCGCGAAGAAGGAAGTCATCCTCTCCGCTGGCGTGGTGAGAACTT
CAAGTCCTTCTCATGTCCCTCCCATTCAAACTTGTCCCATCTGACGTCCAAGACAGTTCCAATCACCGCAACTCC
TCATGGTCTCGGGCGTCGGTCCCCCGGAGACACTGACCAGGCACAAGATCCCCATCGTCGCCTCCCTCCCGGGCG
TAGGCCGCAACATGCAAGATCACATCGTCGTCGGCACCACCTACCGAGTCAAGACGCCGACGCACTCGTCCGTCA
CCAACGCCACCGTCCTGCGGGACTCGGAGGCCGAGTGGAACGCTACCGGCTCCGGCATCCTCGGGAACCCCGGCG
GAGAGCTCATCGCCTGGGAGAGACTGACTGCCGAGTCTGGCAAGTTCAGCGAGGGGACCGGGGCCGTCTTGTCTT
CCGTTCCGGGGGATTTCCCCACGGTCGAGTATCTTATTCTTGATGCTTATAGCGGGAACAACGAGAATTACGTTA
CGGGCGCGCCGGATACGCCGTACATGTACGCCTCGCCCGTGGCGGCCGTTCACGTCCCTCAGAGCAGGGGAAGCG
TCACAATCTCCAGCCCCGACACCTCCATCCCCCCGGTCATAGACCCAGCCTGGCTAACGCACGCCGTCGACCGCG
AACTCGCACTCTACGCCTTCCGCCGCCTCCGCCAACTGATGGACACGCGAGCCGTGAAGCCCGTCTGGACGAGCG
AGGTGGTTCCGGGGAGGAACGTGACGTCGGACGCGGAGATTCTCGCCGTCATGGGTCGCAACGCCATACAGGAGT
TTCACGCTTCGTGTACGTGTAGGATGGGGGTCGAGGGGATGCGGATGCGGTTGTCGATTCGAGGGGGAGGGTTTT
TGGGACGGGGGGTTGAGGGTTGTTGATTCTTCGGCTTTGCCGTTTTTGCCGGCTGGGCATCCGCAGGGGTTGATA
TGTGAGTTTCTGAGCTTGAGTCTGGCGTCTGAGTTGGGTGCGTAGTTTGCTGACCGGTTGCAGATGCTTTGGCGG
AGAAGTTGAGTGAGGATATTTTGAAAGACTTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail