Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02742
Gene name
Locationscaffold_02:4585731..4588534
Strand+
Gene length (bp)2803
Transcript length (bp)2685
Coding sequence length (bp)2685
Protein length (aa) 895

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01189 Methyltr_RsmB-F 16S rRNA methyltransferase RsmB/F 1.6E-26 237 470

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.4831 0.8392 0.229 0.0303 0.3181 0.0026 0.0658 0.0051 0.0325 0.005

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1670
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3649
Ophiocordyceps australis map64 (Brazil) OphauB2|1246
Ophiocordyceps camponoti-floridani Ophcf2|02742 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1564
Ophiocordyceps kimflemingae Ophio5|246
Ophiocordyceps subramaniannii Hirsu2|1421

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02742
MGKKGFRGKNRRGGGQFRGGGQAGGGWRDCAPIPKENEKFQEYYDSLLRLPVEEKQLYWEALRRELPNSFRFCGS
KGHALAVRRLLKTRYIPEIVKIEKDDGRPVEAPIPVSWYPDDLAWWMTTPKNIVRKFPPFAAFQKFLVSETSIGN
ISRQEVVSMIPPLLMDLRPGMTVLDMCAAPGSKSAQLIEMIHRGEEARVRKVLRAFAQEDGLDLGRETQEEIEAD
VEADPHDDGRATGLLIANDSDYKRCHLLVHQLKRLSSPNLIVTNNDATQYPSFKLASKDATSNKNVYLRFDRILA
DVPCSGDGTFRKNANLWRDWQPGNALGLHHTQIRILVRALQLLKVGGRVVYSTCSMNPVENESVVTAAIERCGGQ
ANVDIVDCHDQLPALKRRPGMKSWKIMDKSGRMWESWADVETFAKTEKEGQIPGRLVQTMFPSLEGSDCHDLPLD
RCMRVYPHLQDTGAFFIAVLEKKADFKAKNENEPKKATEEGKTATTEDAVEEAATAETSLSVTEKMDKTEDASSG
DAVSKSNKRPPEAADGEQQAAKKIKTDDGEQNDVQMQDRPLDQIQTEQGEQQMAGKPKAQVAAVQPPRPRGKAHN
VPGTDEPFKYLDPSHPTIENIKKFYKISTRFPDNRFLVRNDMGEPAKAIYYTTALSREILTENEGRGVRFVHGGV
RMFMKQDVPSAEVCRWRIQAEGMPILQGYVGEPRVVHLRNKETLRKLLVEMFPRISGDSWRDFDEIGEQVRDVGM
GCCVLRVEPDGEDPEFSERMALPLWKSIQSLNLMLPKEDRSAMLLRVFNDTTPLINKTLQKDKMADSKSNGAATR
NEADNDVDADAALEDMPTPEEMDKVEPASAADDATLKADKTAGDNSASVAEEATSKGDEAEQAEKGDGV*
Coding >Ophcf2|02742
ATGGGCAAGAAAGGCTTCAGAGGCAAGAACAGGCGCGGCGGCGGTCAGTTCAGAGGCGGCGGCCAAGCTGGCGGA
GGCTGGCGCGATTGCGCCCCCATCCCTAAGGAGAACGAAAAGTTCCAGGAATATTACGACTCGCTGCTTCGGCTC
CCTGTGGAAGAGAAGCAGCTGTATTGGGAGGCTCTGCGCCGCGAGCTTCCCAACAGCTTCAGGTTTTGCGGCTCC
AAGGGTCATGCTCTTGCCGTCAGGCGACTGCTCAAGACTCGATATATACCGGAAATAGTCAAGATCGAGAAGGAC
GATGGCAGACCCGTTGAGGCACCCATCCCGGTGTCTTGGTATCCCGACGATCTGGCCTGGTGGATGACTACGCCC
AAGAACATTGTCCGAAAGTTCCCTCCCTTTGCCGCCTTTCAAAAGTTTCTTGTCTCCGAGACCAGCATCGGCAAC
ATCAGTCGCCAGGAGGTCGTCAGCATGATTCCGCCCCTTCTCATGGACTTGCGGCCAGGCATGACCGTCTTGGAC
ATGTGCGCCGCGCCGGGAAGCAAGTCTGCCCAGCTGATCGAGATGATTCACCGCGGAGAGGAGGCTCGCGTTCGA
AAGGTTCTTCGCGCCTTTGCTCAGGAGGATGGGCTTGATCTGGGACGAGAGACGCAAGAAGAGATCGAGGCAGAT
GTCGAGGCGGACCCTCACGATGATGGTAGAGCCACCGGCCTCTTGATCGCCAACGATTCCGATTACAAACGCTGT
CATCTGCTCGTGCATCAGCTCAAGCGCCTGTCCTCCCCCAATCTCATCGTTACCAACAATGACGCCACGCAGTAC
CCGTCTTTCAAGCTTGCGTCCAAAGACGCTACCTCCAACAAGAATGTCTACCTTCGTTTCGACAGGATACTTGCA
GACGTCCCGTGCTCTGGTGACGGAACTTTTCGCAAGAACGCTAACTTGTGGAGGGATTGGCAGCCGGGCAACGCC
CTTGGACTGCACCACACACAGATCAGAATCTTGGTGCGTGCACTTCAGCTGCTCAAGGTCGGAGGGCGCGTCGTC
TACTCTACCTGCAGCATGAACCCGGTTGAGAACGAGTCTGTTGTGACCGCGGCCATCGAGCGTTGCGGAGGGCAG
GCAAACGTCGACATCGTCGACTGTCACGATCAGCTTCCGGCCTTGAAGCGCAGACCTGGAATGAAGAGTTGGAAA
ATCATGGATAAATCCGGTCGCATGTGGGAGTCTTGGGCAGACGTTGAGACCTTCGCCAAGACGGAGAAGGAGGGA
CAGATTCCGGGTCGACTGGTGCAGACAATGTTTCCCAGTCTCGAGGGGTCCGACTGTCACGACTTACCTCTTGAT
CGCTGCATGAGAGTTTACCCTCATCTGCAGGACACGGGCGCCTTCTTCATCGCGGTTCTGGAGAAGAAGGCCGAC
TTCAAGGCGAAGAATGAGAACGAGCCCAAAAAGGCCACAGAAGAGGGCAAGACAGCGACGACCGAAGACGCTGTC
GAGGAGGCAGCGACGGCGGAGACATCTCTGTCTGTAACGGAAAAGATGGACAAGACAGAGGACGCTTCTTCGGGC
GATGCGGTGAGCAAATCTAACAAGAGGCCACCGGAAGCCGCCGACGGAGAGCAGCAGGCGGCCAAGAAGATTAAG
ACGGACGACGGCGAGCAGAACGACGTCCAAATGCAAGATCGGCCGCTTGACCAGATCCAAACGGAGCAAGGGGAG
CAACAGATGGCTGGTAAGCCCAAGGCACAGGTTGCTGCTGTTCAGCCGCCTCGGCCTCGGGGCAAAGCTCACAAC
GTCCCCGGTACAGATGAGCCATTCAAATATTTGGATCCATCGCATCCTACCATCGAAAATATCAAGAAGTTCTAC
AAAATCTCCACTCGCTTTCCCGATAACCGCTTCTTGGTTCGCAACGACATGGGCGAGCCCGCCAAGGCCATCTAC
TACACCACGGCGCTGAGCCGAGAGATCCTGACGGAGAACGAGGGTCGCGGCGTCAGGTTCGTCCACGGCGGCGTG
CGCATGTTCATGAAGCAGGACGTCCCCTCGGCCGAGGTTTGCCGCTGGCGCATCCAGGCCGAGGGCATGCCCATA
CTTCAGGGATACGTTGGCGAGCCGCGCGTGGTGCACCTCCGCAATAAGGAGACCCTGCGCAAGCTTCTCGTCGAG
ATGTTTCCCCGCATCTCGGGCGACTCTTGGCGGGACTTTGACGAGATTGGCGAACAGGTGCGTGACGTTGGCATG
GGTTGCTGCGTCCTGCGCGTCGAGCCGGATGGCGAGGATCCAGAGTTCTCGGAGCGTATGGCCCTGCCGTTGTGG
AAGAGCATCCAGTCTCTCAACCTTATGCTGCCCAAGGAGGACCGGTCTGCCATGCTGTTGCGCGTCTTTAACGAC
ACCACCCCCCTCATCAACAAGACTCTGCAGAAGGACAAGATGGCTGATAGCAAGAGCAACGGCGCCGCAACCCGA
AACGAAGCAGACAACGACGTAGACGCGGATGCAGCCCTCGAGGACATGCCGACGCCGGAAGAGATGGACAAGGTC
GAGCCAGCTTCTGCTGCAGATGATGCGACGTTGAAGGCGGACAAGACGGCAGGCGACAACTCGGCCTCTGTTGCG
GAGGAGGCGACGTCCAAGGGAGATGAGGCAGAACAGGCCGAAAAGGGAGATGGGGTTTGA
Transcript >Ophcf2|02742
ATGGGCAAGAAAGGCTTCAGAGGCAAGAACAGGCGCGGCGGCGGTCAGTTCAGAGGCGGCGGCCAAGCTGGCGGA
GGCTGGCGCGATTGCGCCCCCATCCCTAAGGAGAACGAAAAGTTCCAGGAATATTACGACTCGCTGCTTCGGCTC
CCTGTGGAAGAGAAGCAGCTGTATTGGGAGGCTCTGCGCCGCGAGCTTCCCAACAGCTTCAGGTTTTGCGGCTCC
AAGGGTCATGCTCTTGCCGTCAGGCGACTGCTCAAGACTCGATATATACCGGAAATAGTCAAGATCGAGAAGGAC
GATGGCAGACCCGTTGAGGCACCCATCCCGGTGTCTTGGTATCCCGACGATCTGGCCTGGTGGATGACTACGCCC
AAGAACATTGTCCGAAAGTTCCCTCCCTTTGCCGCCTTTCAAAAGTTTCTTGTCTCCGAGACCAGCATCGGCAAC
ATCAGTCGCCAGGAGGTCGTCAGCATGATTCCGCCCCTTCTCATGGACTTGCGGCCAGGCATGACCGTCTTGGAC
ATGTGCGCCGCGCCGGGAAGCAAGTCTGCCCAGCTGATCGAGATGATTCACCGCGGAGAGGAGGCTCGCGTTCGA
AAGGTTCTTCGCGCCTTTGCTCAGGAGGATGGGCTTGATCTGGGACGAGAGACGCAAGAAGAGATCGAGGCAGAT
GTCGAGGCGGACCCTCACGATGATGGTAGAGCCACCGGCCTCTTGATCGCCAACGATTCCGATTACAAACGCTGT
CATCTGCTCGTGCATCAGCTCAAGCGCCTGTCCTCCCCCAATCTCATCGTTACCAACAATGACGCCACGCAGTAC
CCGTCTTTCAAGCTTGCGTCCAAAGACGCTACCTCCAACAAGAATGTCTACCTTCGTTTCGACAGGATACTTGCA
GACGTCCCGTGCTCTGGTGACGGAACTTTTCGCAAGAACGCTAACTTGTGGAGGGATTGGCAGCCGGGCAACGCC
CTTGGACTGCACCACACACAGATCAGAATCTTGGTGCGTGCACTTCAGCTGCTCAAGGTCGGAGGGCGCGTCGTC
TACTCTACCTGCAGCATGAACCCGGTTGAGAACGAGTCTGTTGTGACCGCGGCCATCGAGCGTTGCGGAGGGCAG
GCAAACGTCGACATCGTCGACTGTCACGATCAGCTTCCGGCCTTGAAGCGCAGACCTGGAATGAAGAGTTGGAAA
ATCATGGATAAATCCGGTCGCATGTGGGAGTCTTGGGCAGACGTTGAGACCTTCGCCAAGACGGAGAAGGAGGGA
CAGATTCCGGGTCGACTGGTGCAGACAATGTTTCCCAGTCTCGAGGGGTCCGACTGTCACGACTTACCTCTTGAT
CGCTGCATGAGAGTTTACCCTCATCTGCAGGACACGGGCGCCTTCTTCATCGCGGTTCTGGAGAAGAAGGCCGAC
TTCAAGGCGAAGAATGAGAACGAGCCCAAAAAGGCCACAGAAGAGGGCAAGACAGCGACGACCGAAGACGCTGTC
GAGGAGGCAGCGACGGCGGAGACATCTCTGTCTGTAACGGAAAAGATGGACAAGACAGAGGACGCTTCTTCGGGC
GATGCGGTGAGCAAATCTAACAAGAGGCCACCGGAAGCCGCCGACGGAGAGCAGCAGGCGGCCAAGAAGATTAAG
ACGGACGACGGCGAGCAGAACGACGTCCAAATGCAAGATCGGCCGCTTGACCAGATCCAAACGGAGCAAGGGGAG
CAACAGATGGCTGGTAAGCCCAAGGCACAGGTTGCTGCTGTTCAGCCGCCTCGGCCTCGGGGCAAAGCTCACAAC
GTCCCCGGTACAGATGAGCCATTCAAATATTTGGATCCATCGCATCCTACCATCGAAAATATCAAGAAGTTCTAC
AAAATCTCCACTCGCTTTCCCGATAACCGCTTCTTGGTTCGCAACGACATGGGCGAGCCCGCCAAGGCCATCTAC
TACACCACGGCGCTGAGCCGAGAGATCCTGACGGAGAACGAGGGTCGCGGCGTCAGGTTCGTCCACGGCGGCGTG
CGCATGTTCATGAAGCAGGACGTCCCCTCGGCCGAGGTTTGCCGCTGGCGCATCCAGGCCGAGGGCATGCCCATA
CTTCAGGGATACGTTGGCGAGCCGCGCGTGGTGCACCTCCGCAATAAGGAGACCCTGCGCAAGCTTCTCGTCGAG
ATGTTTCCCCGCATCTCGGGCGACTCTTGGCGGGACTTTGACGAGATTGGCGAACAGGTGCGTGACGTTGGCATG
GGTTGCTGCGTCCTGCGCGTCGAGCCGGATGGCGAGGATCCAGAGTTCTCGGAGCGTATGGCCCTGCCGTTGTGG
AAGAGCATCCAGTCTCTCAACCTTATGCTGCCCAAGGAGGACCGGTCTGCCATGCTGTTGCGCGTCTTTAACGAC
ACCACCCCCCTCATCAACAAGACTCTGCAGAAGGACAAGATGGCTGATAGCAAGAGCAACGGCGCCGCAACCCGA
AACGAAGCAGACAACGACGTAGACGCGGATGCAGCCCTCGAGGACATGCCGACGCCGGAAGAGATGGACAAGGTC
GAGCCAGCTTCTGCTGCAGATGATGCGACGTTGAAGGCGGACAAGACGGCAGGCGACAACTCGGCCTCTGTTGCG
GAGGAGGCGACGTCCAAGGGAGATGAGGCAGAACAGGCCGAAAAGGGAGATGGGGTTTGA
Gene >Ophcf2|02742
ATGGGCAAGAAAGGCTTCAGAGTAAGAAGCATATTTCCGAATCCCCCCTCCAAGAGATTCCCCCACTCAGGACTG
CTACAGGGCAAGAACAGGCGCGGCGGCGGTCAGTTCAGAGGCGGCGGCCAAGCTGGCGGAGGCTGGCGCGATTGC
GCCCCCATCCCTAAGGAGAACGAAAAGTTCCAGGAATATTACGACTCGCTGCTTCGGCTCCCTGTGGAAGAGAAG
CAGCTGTATTGGGAGGCTCTGCGCCGCGAGCTTCCCAACAGCTTCAGGTTTTGCGGCTCCAAGGGGTATGCCGCT
CTCGGGTGTTGCTCGTGGATGCAATCAGGCTGACGGCTAATCCCGCAGTCATGCTCTTGCCGTCAGGCGACTGCT
CAAGACTCGATATATACCGGAAATAGTCAAGATCGAGAAGGACGATGGCAGACCCGTTGAGGCACCCATCCCGGT
GTCTTGGTATCCCGACGATCTGGCCTGGTGGATGACTACGCCCAAGAACATTGTCCGAAAGTTCCCTCCCTTTGC
CGCCTTTCAAAAGTTTCTTGTCTCCGAGACCAGCATCGGCAACATCAGTCGCCAGGAGGTCGTCAGCATGATTCC
GCCCCTTCTCATGGACTTGCGGCCAGGCATGACCGTCTTGGACATGTGCGCCGCGCCGGGAAGCAAGTCTGCCCA
GCTGATCGAGATGATTCACCGCGGAGAGGAGGCTCGCGTTCGAAAGGTTCTTCGCGCCTTTGCTCAGGAGGATGG
GCTTGATCTGGGACGAGAGACGCAAGAAGAGATCGAGGCAGATGTCGAGGCGGACCCTCACGATGATGGTAGAGC
CACCGGCCTCTTGATCGCCAACGATTCCGATTACAAACGCTGTCATCTGCTCGTGCATCAGCTCAAGCGCCTGTC
CTCCCCCAATCTCATCGTTACCAACAATGACGCCACGCAGTACCCGTCTTTCAAGCTTGCGTCCAAAGACGCTAC
CTCCAACAAGAATGTCTACCTTCGTTTCGACAGGATACTTGCAGACGTCCCGTGCTCTGGTGACGGAACTTTTCG
CAAGAACGCTAACTTGTGGAGGGATTGGCAGCCGGGCAACGCCCTTGGACTGCACCACACACAGATCAGAATCTT
GGTGCGTGCACTTCAGCTGCTCAAGGTCGGAGGGCGCGTCGTCTACTCTACCTGCAGCATGAACCCGGTTGAGAA
CGAGTCTGTTGTGACCGCGGCCATCGAGCGTTGCGGAGGGCAGGCAAACGTCGACATCGTCGACTGTCACGATCA
GCTTCCGGCCTTGAAGCGCAGACCTGGAATGAAGAGTTGGAAAATCATGGATAAATCCGGTCGCATGTGGGAGTC
TTGGGCAGACGTTGAGACCTTCGCCAAGACGGAGAAGGAGGGACAGATTCCGGGTCGACTGGTGCAGACAATGTT
TCCCAGTCTCGAGGGGTCCGACTGTCACGACTTACCTCTTGATCGCTGCATGAGAGTTTACCCTCATCTGCAGGA
CACGGGCGCCTTCTTCATCGCGGTTCTGGAGAAGAAGGCCGACTTCAAGGCGAAGAATGAGAACGAGCCCAAAAA
GGCCACAGAAGAGGGCAAGACAGCGACGACCGAAGACGCTGTCGAGGAGGCAGCGACGGCGGAGACATCTCTGTC
TGTAACGGAAAAGATGGACAAGACAGAGGACGCTTCTTCGGGCGATGCGGTGAGCAAATCTAACAAGAGGCCACC
GGAAGCCGCCGACGGAGAGCAGCAGGCGGCCAAGAAGATTAAGACGGACGACGGCGAGCAGAACGACGTCCAAAT
GCAAGATCGGCCGCTTGACCAGATCCAAACGGAGCAAGGGGAGCAACAGATGGCTGGTAAGCCCAAGGCACAGGT
TGCTGCTGTTCAGCCGCCTCGGCCTCGGGGCAAAGCTCACAACGTCCCCGGTACAGATGAGCCATTCAAATATTT
GGATCCATCGCATCCTACCATCGAAAATATCAAGAAGTTCTACAAAATCTCCACTCGCTTTCCCGATAACCGCTT
CTTGGTTCGCAACGACATGGGCGAGCCCGCCAAGGCCATCTACTACACCACGGCGCTGAGCCGAGAGATCCTGAC
GGAGAACGAGGGTCGCGGCGTCAGGTTCGTCCACGGCGGCGTGCGCATGTTCATGAAGCAGGACGTCCCCTCGGC
CGAGGTTTGCCGCTGGCGCATCCAGGCCGAGGGCATGCCCATACTTCAGGGATACGTTGGCGAGCCGCGCGTGGT
GCACCTCCGCAATAAGGAGACCCTGCGCAAGCTTCTCGTCGAGATGTTTCCCCGCATCTCGGGCGACTCTTGGCG
GGACTTTGACGAGATTGGCGAACAGGTGCGTGACGTTGGCATGGGTTGCTGCGTCCTGCGCGTCGAGCCGGATGG
CGAGGATCCAGAGTTCTCGGAGCGTATGGCCCTGCCGTTGTGGAAGAGCATCCAGTCTCTCAACCTTATGCTGCC
CAAGGAGGACCGGTCTGCCATGCTGTTGCGCGTCTTTAACGACACCACCCCCCTCATCAACAAGACTCTGCAGAA
GGACAAGATGGCTGATAGCAAGAGCAACGGCGCCGCAACCCGAAACGAAGCAGACAACGACGTAGACGCGGATGC
AGCCCTCGAGGACATGCCGACGCCGGAAGAGATGGACAAGGTCGAGCCAGCTTCTGCTGCAGATGATGCGACGTT
GAAGGCGGACAAGACGGCAGGCGACAACTCGGCCTCTGTTGCGGAGGAGGCGACGTCCAAGGGAGATGAGGCAGA
ACAGGCCGAAAAGGGAGATGGGGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail