Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02738
Gene name
Locationscaffold_02:4557232..4560484
Strand+
Gene length (bp)3252
Transcript length (bp)3129
Coding sequence length (bp)3129
Protein length (aa) 1043

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04192 Utp21 Utp21 specific WD40 associated putative domain 2.1E-77 833 1038
PF00400 WD40 WD domain, G-beta repeat 7.0E-03 377 417
PF00400 WD40 WD domain, G-beta repeat 1.6E-02 621 650
PF00400 WD40 WD domain, G-beta repeat 1.6E-07 698 735
PF02239 Cytochrom_D1 Cytochrome D1 heme domain 4.0E-08 685 801

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0032040 small-subunit processome Yes
GO:0006364 rRNA processing Yes
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0006396 RNA processing No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0005488 binding No
GO:0043170 macromolecule metabolic process No
GO:0032991 protein-containing complex No
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0005575 cellular_component No
GO:1990904 ribonucleoprotein complex No
GO:0006807 nitrogen compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0003674 molecular_function No
GO:0030684 preribosome No
GO:0090304 nucleic acid metabolic process No
GO:0016072 rRNA metabolic process No
GO:0034470 ncRNA processing No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2024 0.8888 0.0257 0.0094 0.0497 0.0042 0.1177 0.0766 0.0567 0.0023

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1672
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3651
Ophiocordyceps australis map64 (Brazil) OphauB2|1250
Ophiocordyceps camponoti-floridani Ophcf2|02738 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1568
Ophiocordyceps kimflemingae Ophio5|8400
Ophiocordyceps subramaniannii Hirsu2|1425

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02738
MPTSQVDGPLPKRRRTCASVVSTGQDTKTSRIFAPFRTVGLVSPTCVPFTSTPLGKTTFQITTSVGRALQTYDLL
RGLNLVFVTRPQTPADVTATVAWRGKILAAWGGTKNVEPQGLWVFQRGRKVDELKLPPDMAEPVKQIMTFGKWLV
VCAMTRVEVFKSESLEHYTTIHTMPAAEAGNEITGGVTTMPTFLNKIFLGRRDGRVEMWNVKTGKLIYTFMPFSP
DCGSVTCLEPSPALSLMAIAYSEGSLIITDIVTDRPLLQIEAGNPEAPVNCISFRTDGTGAGSDGRKDGVMATAT
AASGDVTFWDLNGGGRVMGVLRSAHNPPSRDGRLIPGGLTKIEFLSGQPVIVTSGRDNSLKSWIFDKTPFSPVPR
ILHSRSGHAGPVNCLHFLPSDFDGFEAGNKWLLSGGRDRSLWGWSLRRDGQSTELSQGAIRKKAGKVGILAANAL
AHGPVSTLEDLKAPEITCIATSLNRDGGIGAIPGKQLIWQKGQGRPKATDAEVSGATGWESVVTAHRGDSFARTW
FWGRKRAGRWALPSGDSSNVSTVAISPCGSFAVIGSESGSIVMYNLQSGIRRQQFPSKVSPAQARQLRLRQLQQA
DDVAQLHVETGRRFPPGTGKHTKRVTGIVVDSMNKYIISCSLDGMVKFWDFLTGTLLNQIDWSFKSAPAMCRYHA
ANGLLAFACGDNSIRIVDMETKKTIREFRGPRDAINDLCFSSDGRWIIGASRDGLIRIWDLPTSHLIDAIRLERP
CTALSMSSSGEYLAATIENEPGVSIWSNKSLFRHVPTRQISEDDVGQISAPTVSGEGNQGLLEGAFEDDESAADD
EMAAPTTEQLSPDMMTLSTVPKSRWQTLLHLDLIKERNKPKEPPKAPEKAPFFLPSTSSAPSPALQDAAATTDEQ
AKSRITKLDQARLEERFSSVLRKAAMTGDYDDFITHLKSLSPSSADLELRSLSIGNGNAETNELLHFIQALIARL
EARSDYELTQAWMTVFLRLHVDVVSQSEVLLSALRRWRAQQMRESRRLDELVGYCSGVVGFLRSPWT*
Coding >Ophcf2|02738
ATGCCGACCTCTCAAGTAGACGGACCGCTGCCGAAGCGTCGTCGGACCTGCGCCAGCGTCGTCTCTACCGGCCAG
GATACAAAGACGTCTCGTATCTTCGCCCCTTTCAGAACGGTGGGCCTTGTGTCCCCGACCTGCGTTCCTTTCACG
TCTACCCCCCTTGGAAAGACGACCTTTCAGATCACAACGTCCGTCGGCCGGGCTCTGCAGACTTATGATCTGCTG
CGCGGCCTTAACCTCGTCTTCGTTACCCGGCCGCAGACTCCAGCCGATGTCACGGCCACCGTTGCCTGGAGAGGC
AAGATCCTTGCAGCATGGGGTGGAACGAAAAATGTCGAGCCTCAAGGCCTTTGGGTCTTTCAGCGCGGCAGAAAA
GTGGACGAGTTGAAGCTGCCCCCCGATATGGCCGAGCCCGTCAAGCAAATTATGACCTTTGGAAAGTGGCTTGTC
GTCTGTGCCATGACGAGAGTCGAAGTTTTCAAATCTGAAAGTCTAGAGCATTACACCACAATTCACACCATGCCG
GCTGCTGAGGCCGGCAACGAAATCACCGGTGGCGTCACCACTATGCCGACATTTCTCAATAAGATCTTCCTGGGC
CGTAGAGACGGCAGAGTTGAGATGTGGAACGTCAAGACGGGCAAGCTAATCTATACGTTTATGCCCTTTTCTCCC
GACTGCGGCTCCGTGACGTGCCTGGAACCGAGTCCGGCCCTGTCTCTCATGGCAATCGCCTACTCGGAGGGCTCG
TTAATCATTACCGACATCGTGACCGACAGGCCGCTTCTACAAATTGAGGCGGGGAACCCAGAAGCGCCCGTCAAC
TGCATCTCCTTTAGAACTGACGGCACAGGAGCTGGATCCGACGGCAGGAAAGACGGCGTCATGGCCACGGCCACG
GCCGCGAGTGGCGACGTGACTTTCTGGGACTTGAACGGCGGCGGCCGCGTCATGGGCGTTCTGCGCAGCGCTCAC
AATCCGCCATCTCGCGACGGTCGTCTCATTCCCGGAGGCTTGACCAAAATTGAATTTCTGTCTGGTCAGCCCGTC
ATTGTCACCAGTGGTCGCGATAACTCACTGAAGTCATGGATCTTTGACAAGACGCCCTTTTCTCCCGTGCCGAGG
ATACTGCATTCGCGCAGTGGTCACGCTGGACCCGTCAACTGCCTTCATTTCCTGCCTTCCGACTTTGACGGCTTT
GAAGCCGGAAACAAGTGGCTTCTCAGCGGAGGAAGAGACAGGAGTCTCTGGGGATGGAGCTTACGCCGCGACGGC
CAGAGTACGGAGCTCAGCCAGGGCGCCATCCGCAAAAAGGCCGGCAAAGTTGGTATACTCGCCGCCAACGCACTG
GCCCATGGCCCCGTATCGACCTTGGAGGATCTCAAAGCCCCTGAAATCACTTGCATCGCCACCTCGCTCAATCGT
GACGGTGGAATCGGCGCCATACCTGGGAAGCAGCTCATCTGGCAAAAGGGCCAAGGCCGACCCAAGGCTACCGAT
GCAGAGGTGAGCGGAGCCACGGGTTGGGAAAGTGTTGTCACGGCGCACAGGGGAGACTCCTTCGCTCGAACCTGG
TTCTGGGGTCGCAAACGCGCTGGACGCTGGGCTCTGCCATCCGGCGATAGCTCAAACGTCTCGACCGTGGCCATC
AGCCCGTGTGGAAGCTTCGCCGTCATCGGATCCGAGTCGGGCAGCATCGTCATGTACAATCTTCAGTCCGGCATC
CGTCGACAACAATTCCCGTCCAAAGTGAGTCCGGCACAGGCGCGACAGTTGAGACTGCGGCAACTGCAGCAGGCC
GACGACGTGGCTCAGCTGCATGTTGAAACCGGCCGTCGTTTCCCCCCTGGCACTGGCAAGCACACGAAGCGTGTG
ACTGGCATCGTGGTCGACTCGATGAATAAGTACATCATCTCTTGTTCTTTGGACGGCATGGTCAAGTTCTGGGAC
TTTTTGACGGGCACTTTGCTCAACCAAATCGACTGGTCTTTCAAGTCGGCTCCGGCCATGTGCAGATATCATGCC
GCAAATGGCTTGCTGGCATTCGCCTGCGGTGACAATTCGATCCGTATCGTTGACATGGAGACAAAGAAGACGATT
CGAGAATTTCGAGGTCCGCGCGACGCCATCAACGACCTCTGTTTCTCGAGCGATGGTCGCTGGATCATCGGTGCC
TCTCGAGACGGTCTGATTCGCATCTGGGACTTGCCGACGAGCCACTTGATCGACGCCATTCGCCTCGAAAGACCC
TGCACCGCACTGTCCATGTCCTCAAGCGGAGAGTATCTCGCCGCCACGATCGAAAATGAGCCGGGCGTCTCCATC
TGGTCCAACAAGTCCTTGTTCCGACACGTACCGACTCGGCAAATCTCCGAGGACGACGTCGGCCAAATCTCCGCG
CCGACTGTGTCAGGCGAAGGAAACCAAGGCCTTCTAGAAGGCGCTTTCGAAGATGACGAGTCGGCAGCGGACGAT
GAGATGGCGGCGCCTACGACAGAACAGCTCAGCCCCGATATGATGACGCTCAGCACCGTTCCCAAGAGCCGCTGG
CAGACGCTGCTGCACCTAGATCTGATCAAGGAACGCAACAAGCCAAAGGAGCCGCCAAAGGCACCGGAAAAGGCG
CCTTTCTTCCTCCCATCCACTTCCAGTGCCCCGTCACCCGCTCTGCAGGACGCAGCAGCAACGACAGACGAGCAA
GCCAAGTCTCGAATCACGAAGCTCGACCAGGCACGCTTGGAGGAGAGATTCTCATCCGTGCTTCGCAAGGCAGCG
ATGACAGGAGACTACGACGACTTTATAACCCACCTCAAATCACTCTCACCCTCAAGCGCAGACCTCGAACTCCGC
TCCCTCTCCATCGGCAACGGCAACGCCGAGACAAACGAGCTGCTACACTTCATCCAAGCGCTCATCGCCCGACTC
GAAGCCCGATCGGACTACGAGCTCACGCAGGCGTGGATGACGGTCTTCCTGCGTCTCCACGTCGACGTCGTGTCG
CAGAGCGAGGTGCTTCTCTCTGCGCTTCGGCGATGGAGGGCGCAGCAGATGAGGGAGAGTAGGCGGTTGGATGAA
CTTGTTGGGTATTGTAGTGGTGTTGTGGGCTTTTTGAGGAGTCCGTGGACGTAG
Transcript >Ophcf2|02738
ATGCCGACCTCTCAAGTAGACGGACCGCTGCCGAAGCGTCGTCGGACCTGCGCCAGCGTCGTCTCTACCGGCCAG
GATACAAAGACGTCTCGTATCTTCGCCCCTTTCAGAACGGTGGGCCTTGTGTCCCCGACCTGCGTTCCTTTCACG
TCTACCCCCCTTGGAAAGACGACCTTTCAGATCACAACGTCCGTCGGCCGGGCTCTGCAGACTTATGATCTGCTG
CGCGGCCTTAACCTCGTCTTCGTTACCCGGCCGCAGACTCCAGCCGATGTCACGGCCACCGTTGCCTGGAGAGGC
AAGATCCTTGCAGCATGGGGTGGAACGAAAAATGTCGAGCCTCAAGGCCTTTGGGTCTTTCAGCGCGGCAGAAAA
GTGGACGAGTTGAAGCTGCCCCCCGATATGGCCGAGCCCGTCAAGCAAATTATGACCTTTGGAAAGTGGCTTGTC
GTCTGTGCCATGACGAGAGTCGAAGTTTTCAAATCTGAAAGTCTAGAGCATTACACCACAATTCACACCATGCCG
GCTGCTGAGGCCGGCAACGAAATCACCGGTGGCGTCACCACTATGCCGACATTTCTCAATAAGATCTTCCTGGGC
CGTAGAGACGGCAGAGTTGAGATGTGGAACGTCAAGACGGGCAAGCTAATCTATACGTTTATGCCCTTTTCTCCC
GACTGCGGCTCCGTGACGTGCCTGGAACCGAGTCCGGCCCTGTCTCTCATGGCAATCGCCTACTCGGAGGGCTCG
TTAATCATTACCGACATCGTGACCGACAGGCCGCTTCTACAAATTGAGGCGGGGAACCCAGAAGCGCCCGTCAAC
TGCATCTCCTTTAGAACTGACGGCACAGGAGCTGGATCCGACGGCAGGAAAGACGGCGTCATGGCCACGGCCACG
GCCGCGAGTGGCGACGTGACTTTCTGGGACTTGAACGGCGGCGGCCGCGTCATGGGCGTTCTGCGCAGCGCTCAC
AATCCGCCATCTCGCGACGGTCGTCTCATTCCCGGAGGCTTGACCAAAATTGAATTTCTGTCTGGTCAGCCCGTC
ATTGTCACCAGTGGTCGCGATAACTCACTGAAGTCATGGATCTTTGACAAGACGCCCTTTTCTCCCGTGCCGAGG
ATACTGCATTCGCGCAGTGGTCACGCTGGACCCGTCAACTGCCTTCATTTCCTGCCTTCCGACTTTGACGGCTTT
GAAGCCGGAAACAAGTGGCTTCTCAGCGGAGGAAGAGACAGGAGTCTCTGGGGATGGAGCTTACGCCGCGACGGC
CAGAGTACGGAGCTCAGCCAGGGCGCCATCCGCAAAAAGGCCGGCAAAGTTGGTATACTCGCCGCCAACGCACTG
GCCCATGGCCCCGTATCGACCTTGGAGGATCTCAAAGCCCCTGAAATCACTTGCATCGCCACCTCGCTCAATCGT
GACGGTGGAATCGGCGCCATACCTGGGAAGCAGCTCATCTGGCAAAAGGGCCAAGGCCGACCCAAGGCTACCGAT
GCAGAGGTGAGCGGAGCCACGGGTTGGGAAAGTGTTGTCACGGCGCACAGGGGAGACTCCTTCGCTCGAACCTGG
TTCTGGGGTCGCAAACGCGCTGGACGCTGGGCTCTGCCATCCGGCGATAGCTCAAACGTCTCGACCGTGGCCATC
AGCCCGTGTGGAAGCTTCGCCGTCATCGGATCCGAGTCGGGCAGCATCGTCATGTACAATCTTCAGTCCGGCATC
CGTCGACAACAATTCCCGTCCAAAGTGAGTCCGGCACAGGCGCGACAGTTGAGACTGCGGCAACTGCAGCAGGCC
GACGACGTGGCTCAGCTGCATGTTGAAACCGGCCGTCGTTTCCCCCCTGGCACTGGCAAGCACACGAAGCGTGTG
ACTGGCATCGTGGTCGACTCGATGAATAAGTACATCATCTCTTGTTCTTTGGACGGCATGGTCAAGTTCTGGGAC
TTTTTGACGGGCACTTTGCTCAACCAAATCGACTGGTCTTTCAAGTCGGCTCCGGCCATGTGCAGATATCATGCC
GCAAATGGCTTGCTGGCATTCGCCTGCGGTGACAATTCGATCCGTATCGTTGACATGGAGACAAAGAAGACGATT
CGAGAATTTCGAGGTCCGCGCGACGCCATCAACGACCTCTGTTTCTCGAGCGATGGTCGCTGGATCATCGGTGCC
TCTCGAGACGGTCTGATTCGCATCTGGGACTTGCCGACGAGCCACTTGATCGACGCCATTCGCCTCGAAAGACCC
TGCACCGCACTGTCCATGTCCTCAAGCGGAGAGTATCTCGCCGCCACGATCGAAAATGAGCCGGGCGTCTCCATC
TGGTCCAACAAGTCCTTGTTCCGACACGTACCGACTCGGCAAATCTCCGAGGACGACGTCGGCCAAATCTCCGCG
CCGACTGTGTCAGGCGAAGGAAACCAAGGCCTTCTAGAAGGCGCTTTCGAAGATGACGAGTCGGCAGCGGACGAT
GAGATGGCGGCGCCTACGACAGAACAGCTCAGCCCCGATATGATGACGCTCAGCACCGTTCCCAAGAGCCGCTGG
CAGACGCTGCTGCACCTAGATCTGATCAAGGAACGCAACAAGCCAAAGGAGCCGCCAAAGGCACCGGAAAAGGCG
CCTTTCTTCCTCCCATCCACTTCCAGTGCCCCGTCACCCGCTCTGCAGGACGCAGCAGCAACGACAGACGAGCAA
GCCAAGTCTCGAATCACGAAGCTCGACCAGGCACGCTTGGAGGAGAGATTCTCATCCGTGCTTCGCAAGGCAGCG
ATGACAGGAGACTACGACGACTTTATAACCCACCTCAAATCACTCTCACCCTCAAGCGCAGACCTCGAACTCCGC
TCCCTCTCCATCGGCAACGGCAACGCCGAGACAAACGAGCTGCTACACTTCATCCAAGCGCTCATCGCCCGACTC
GAAGCCCGATCGGACTACGAGCTCACGCAGGCGTGGATGACGGTCTTCCTGCGTCTCCACGTCGACGTCGTGTCG
CAGAGCGAGGTGCTTCTCTCTGCGCTTCGGCGATGGAGGGCGCAGCAGATGAGGGAGAGTAGGCGGTTGGATGAA
CTTGTTGGGTATTGTAGTGGTGTTGTGGGCTTTTTGAGGAGTCCGTGGACGTAG
Gene >Ophcf2|02738
ATGCCGACCTCTCAAGTAGACGGACCGCTGCCGAAGCGTCGTCGGACCTGCGCCAGCGTCGTCTCTACCGGCCAG
GATACAAAGACGTCTCGTATCTTCGCCCCTTTCAGAGTATGCCTTGGTCCTCGCCCATCTTTGCCATGGTCTAAT
GCGAGATACAACAGACGGTGGGCCTTGTGTCCCCGACCTGCGTTCCTTTCACGTCTACCCCCCTTGGAAAGACGA
CCTTTCAGATCACAACGTCCGTCGGCCGGGCTCTGCAGACTTATGATCTGCTGCGCGGCCTTAACCTCGTCTTCG
TTACCCGGCCGCAGACTCCAGCCGATGTCACGGCCACCGTTGCCTGGAGAGGCAAGATCCTTGCAGCATGGGGTG
GAACGAAAAATGTCGAGCCTCAAGGCCTTTGGGTCTTTCAGCGCGGCAGAAAAGTGGACGAGTTGAAGCTGCCCC
CCGATATGGCCGAGCCCGTCAAGCAAATTATGACCTTTGGAAAGTGGCTTGTCGTCTGTGCCATGACGAGAGTCG
AAGTTTTCAAATCTGAAAGTCTAGAGCATTACACCACAATTCACACCATGCCGGCTGCTGAGGCCGGCAACGAAA
TCACCGGTGGCGTCACCACTATGCCGACATTTCTCAATAAGATCTTCCTGGGCCGTAGAGACGGCAGAGTTGAGA
TGTGGAACGTCAAGACGGGCAAGCTAATCTATACGTTTATGCCCTTTTCTCCCGACTGCGGCTCCGTGACGTGCC
TGGAACCGAGTCCGGCCCTGTCTCTCATGGCAATCGCCTACTCGGAGGGCTCGTTAATCATTACCGACATCGTGA
CCGACAGGCCGCTTCTACAAATTGAGGCGGGGAACCCAGAAGCGCCCGTCAACTGCATCTCCTTTAGAACTGACG
GCACAGGAGCTGGATCCGACGGCAGGAAAGACGGCGTCATGGCCACGGCCACGGCCGCGAGTGGCGACGTGACTT
TCTGGGACTTGAACGGCGGCGGCCGCGTCATGGGCGTTCTGCGCAGCGCTCACAATCCGCCATCTCGCGACGGTC
GTCTCATTCCCGGAGGCTTGACCAAAATTGAATTTCTGTCTGGTCAGCCCGTCATTGTCACCAGTGGTCGCGATA
ACTCACTGAAGTCATGGATCTTTGACAAGACGCCCTTTTCTCCCGTGCCGAGGATACTGCATTCGCGCAGTGGTC
ACGCTGGACCCGTCAACTGCCTTCATTTCCTGCCTTCCGACTTTGACGGCTTTGAAGCCGGAAACAAGTGGCTTC
TCAGCGGAGGAAGAGACAGGAGTCTCTGGGGATGGAGCTTACGCCGCGACGGCCAGAGTACGGAGCTCAGCCAGG
GCGCCATCCGCAAAAAGGCCGGCAAAGTTGGTATACTCGCCGCCAACGCACTGGCCCATGGCCCCGTATCGACCT
TGGAGGATCTCAAAGCCCCTGAAATCACTTGCATCGCCACCTCGCTCAATCGTGACGGTGGAATCGGCGCCATAC
CTGGGAAGCAGCTCATCTGGCAAAAGGGCCAAGGCCGACCCAAGGCTACCGATGCAGAGGTGAGCGGAGCCACGG
GTTGGGAAAGTGTTGTCACGGCGCACAGGGGAGACTCCTTCGCTCGAACCTGGTTCTGGGGTCGCAAACGCGCTG
GACGCTGGGCTCTGCCATCCGGCGATAGCTCAAACGTCTCGACCGTGGCCATCAGCCCGTGTGGAAGCTTCGCCG
TCATCGGATCCGAGTCGGGCAGCATCGTCATGTACAATCTTCAGTCCGGCATCCGTCGACAACAATTCCCGTCCA
AAGTGAGTCCGGCACAGGCGCGACAGTTGAGACTGCGGCAACTGCAGCAGGCCGACGACGTGGCTCAGCTGCATG
TTGAAACCGGCCGTCGTTTCCCCCCTGGCACTGGCAAGCACACGAAGCGTGTGACTGGCATCGTGGTCGACTCGA
TGAATAAGTACATCATCTCTTGTTCTTTGGACGGCATGGTCAAGTTCTGGGACTTTTTGACGGGCACTTTGCTCA
ACCAAATCGACTGGTCTTTCAAGTCGGCTCCGGCCATGTGCAGATATCATGCCGCAAATGGCTTGCTGGCATTCG
CCTGCGGTGACAATTCGATCCGTATCGTTGACATGGAGACAAAGAAGACGATTCGAGAATTTCGAGGTCCGCGCG
ACGCCATCAACGACCTCTGTTTCTCGAGCGATGGTCGCTGGATCATCGGTGCCTCTCGAGACGGTCTGATTCGCA
TCTGGGACTTGCCGACGAGCCACTTGATCGACGCCATTCGCCTCGAAAGACCCTGCACCGCACTGTCCATGTCCT
CAAGCGGAGAGTATCTCGCCGCCACGATCGAAAATGAGCCGGGCGTCTCCATCTGGTCCAACAAGTCCTTGTTCC
GACACGTACCGACTCGGCAAATCTCCGAGGACGACGTCGGCCAAATCTCCGCGCCGACTGTGTCAGGCGAAGGAA
ACCAAGGCCTTCTAGAAGGCGCTTTCGAAGATGACGAGTCGGCAGCGGACGATGAGATGGCGGCGCCTACGACAG
AACAGCTCAGCCCCGATATGATGACGCTCAGCACCGTTCCCAAGAGCCGCTGGCAGACGCTGCTGCACCTAGATC
TGATCAAGGAACGCAACAAGCCAAAGGAGCCGCCAAAGGCACCGGAAAAGGCGCCTTTCTTCCTCCCATCCACTT
CCAGTGCCCCGTCACCCGCTCTGCAGGACGCAGCAGCAACGACAGACGAGCAAGCCAAGTCTCGAATCACGAAGC
TCGACCAGGCACGCTTGGAGGAGAGATTCTCATCCGTGCTTCGCAAGGCAGCGATGACAGGAGACTGTAAGTTCA
TCTCACCCACCCCCTTCTCCCCCCCCTACCAATAGCTGCAAGTGCTAACCCCCCAGCGCAGACGACGACTTTATA
ACCCACCTCAAATCACTCTCACCCTCAAGCGCAGACCTCGAACTCCGCTCCCTCTCCATCGGCAACGGCAACGCC
GAGACAAACGAGCTGCTACACTTCATCCAAGCGCTCATCGCCCGACTCGAAGCCCGATCGGACTACGAGCTCACG
CAGGCGTGGATGACGGTCTTCCTGCGTCTCCACGTCGACGTCGTGTCGCAGAGCGAGGTGCTTCTCTCTGCGCTT
CGGCGATGGAGGGCGCAGCAGATGAGGGAGAGTAGGCGGTTGGATGAACTTGTTGGGTATTGTAGTGGTGTTGTG
GGCTTTTTGAGGAGTCCGTGGACGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail