Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02737
Gene name
Locationscaffold_02:4551840..4556643
Strand-
Gene length (bp)4803
Transcript length (bp)4443
Coding sequence length (bp)4443
Protein length (aa) 1481

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2) 2.4E-106 755 1364
PF18086 PPIP5K2_N Diphosphoinositol pentakisphosphate kinase 2 N-terminal domain 4.7E-35 273 360
PF08443 RimK RimK-like ATP-grasp domain 1.5E-05 496 586

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6274 0.3645 0.0711 0.198 0.1759 0.0336 0.1274 0.1506 0.2057 0.022

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1673
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3652
Ophiocordyceps australis map64 (Brazil) OphauB2|1251
Ophiocordyceps camponoti-floridani Ophcf2|02737 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1569
Ophiocordyceps kimflemingae Ophio5|8399
Ophiocordyceps subramaniannii Hirsu2|1427

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02737
MMDVATPDDDCHDDGSTGAPPPPPPSPPPPSLPPPPCQRSSRARSISSSSAAGSVASRKSCYAEPGLSHVNAERT
SVASATPHHSPLRASRSRRPNSSVSDDWSEESVSASPDIDTPRPRPLSTVDLASLPEPALAARPSFSEIQSRRLS
ANSLASARSLVVSSPQADIGNPPRSVPSYIMAAGKSPTSSSADPGAPANSPVQGQHHLAQPLDLMRRNQRNDAAI
RPQPDRSRSRAKRRFSGSTAASSHSPSSDRGPQYRDKEEAKPAPWGVIGICALDVKARSKPSRNILNRLIANREF
DVVVFGDKVILDEAVENWPMCDYLISFYSDGFPLDKAIAYVKARKPFSVNDVPMQQVLWDRRVCLRLLDKIQVRT
PKRLEVSRDGGPAVLTPEMSKHIKDISGISLTPTESQGVPVPRHVELMDDGDVLSVDGALLRKPFVEKPTSGEDH
NIIIYFPKSSGGGARKLFRKIGNKSSDYLPDLNVPRAISEPGSSYIYESFMKVDNAEDVKAYTVGPHYCHAETRK
SPVVDGIVRRNTHGKELRYVTGLSAEEKDVASKISTTFGQRVCGFDLLRASGKSYVIDVNGWSFVKDNDDYYDHC
ANILKDMFVKERLRRGGVTPPMPSPAFSDIDPLARAAQAMKDRDQQQPPGTSSGSQSASRAASGTGMLSQGSQHT
DSTRAASEAASNKAESALNSSTQSTETSPVLPPPPPEVTSAGPVSASSSIRTAAAHASNAQPPEGEAMAAPPPPP
KHSWKLKGMVCVIRHADRTPKQKYKFTFHTEPFIALLKGHQEEVLLIGEAALASVIQAVDMALEEGIEDAVKLKA
LRNVLVKKGSWAGTKVQIKPMFRNKPETQPAPDASEAGENARAANAEGEEEGDGNGDGGEGEGRRKPPKRQDSLS
GVTMSKFTAAEERLVLDKLQLIVKWGGEPTHSARYQSQELGENMRNDLMLLNRDVLDEVHVFSSSERRVTASAQI
WAASFLGRKDIPEDFITIRKNLLDDSNAAKDETDKVKKKLKGLLRKGNERPAQFAWPENMPEPSEVQTRVVQLMN
FHRRVMHYNYGKIRSGNGTSLSSVSNASTEKLTAEGSNTSLSSAVSHANSINGIQSRWCSGEDAELFRERWEKLF
TEFCDGDKVDPSKISELYDTMKFDALHNRQFLEWVFTPPKAMLDEEYSLKSTMADENRAVEEQQRDDKGDYGLDR
TDPGSRGATVRKLFRRRSFLNNLRHQHEDTAPEQYFRLYKGTAHKTAAKVDPRNEPLQELYRLAKVLFDFICPQE
YGISDSEKLEIGLLTSLPLLKEIVQDLEEMQASNDAKSFFYFTKESHIYTLLNCIIEGGIETKIKRSTIPELDYL
SQICFELYESEAKQGQQQQQQKQQQQQQQQQQQQQADEPTFSYSIRISISPGCHVSDPLHVQLDSRHCIGCAQRR
SLTPHIDWLQVVKTLRAKFNQVKLPKTTAGKRPSRIARDEMPPPKRWHNPVPDPS*
Coding >Ophcf2|02737
ATGATGGACGTCGCCACTCCCGACGACGACTGCCACGATGATGGCTCCACCGGCGCTCCTCCTCCTCCTCCTCCT
TCTCCTCCTCCTCCTTCTCTTCCTCCTCCACCCTGTCAGCGCTCGTCTCGCGCCCGCAGCATCTCTTCCTCTTCG
GCCGCCGGCTCTGTTGCCAGCAGAAAGAGTTGCTACGCTGAACCGGGCCTCTCGCACGTCAACGCTGAACGCACC
AGCGTCGCCTCCGCAACTCCCCACCACTCCCCACTCAGGGCCTCGAGGTCTCGCCGCCCCAATAGCAGCGTCTCG
GACGACTGGAGCGAGGAATCCGTGTCCGCTAGCCCTGACATCGACACGCCTAGACCCCGTCCGCTGTCCACCGTG
GACCTCGCCTCCCTTCCCGAGCCTGCTCTCGCAGCCCGTCCGTCCTTTTCCGAGATTCAGTCGAGGCGTCTGTCG
GCCAACTCGCTTGCTTCGGCCCGCAGCCTTGTCGTCTCGTCTCCGCAGGCCGATATCGGAAACCCGCCGCGTTCC
GTCCCGAGCTACATCATGGCCGCCGGCAAGAGCCCGACATCTTCCTCTGCCGACCCTGGCGCACCCGCCAATTCG
CCCGTCCAGGGGCAGCACCACCTCGCCCAGCCTCTTGACCTCATGCGACGCAACCAGCGTAACGACGCCGCCATA
CGCCCCCAACCTGACCGCTCCCGCAGTAGGGCAAAGAGGAGGTTCAGTGGTAGCACCGCCGCCAGCAGCCACAGC
CCAAGCAGTGATCGTGGTCCCCAGTACCGCGACAAGGAAGAAGCGAAGCCGGCTCCTTGGGGGGTTATTGGTATT
TGCGCCCTTGACGTCAAGGCCAGAAGCAAGCCGAGCAGAAACATCCTCAACCGTCTCATCGCCAATCGCGAATTC
GACGTGGTCGTCTTTGGCGACAAGGTTATTCTCGATGAAGCGGTCGAGAACTGGCCCATGTGTGACTATCTCATA
TCATTCTACTCCGACGGCTTTCCTCTCGACAAGGCCATCGCCTATGTCAAGGCTCGAAAGCCATTCTCCGTCAAC
GATGTCCCCATGCAGCAGGTTCTATGGGACAGGCGAGTCTGTCTTCGTCTCCTCGATAAGATCCAGGTTCGGACC
CCGAAGCGCCTCGAGGTCAGCCGGGATGGCGGCCCCGCGGTTTTGACTCCCGAAATGTCCAAGCACATCAAGGAC
ATCTCTGGAATTTCCCTGACTCCCACGGAATCTCAAGGGGTGCCCGTGCCGCGGCATGTCGAGCTCATGGACGAT
GGCGATGTGCTGAGCGTGGATGGCGCCCTGCTTCGGAAGCCGTTCGTGGAGAAACCAACGAGTGGCGAAGACCAC
AACATCATCATCTACTTCCCCAAGAGCTCGGGCGGTGGTGCGAGGAAGCTCTTCAGGAAGATTGGCAACAAGAGC
TCCGACTATCTGCCTGATCTCAACGTACCGAGAGCCATTTCGGAACCCGGCAGCAGCTACATCTATGAAAGCTTT
ATGAAAGTCGATAATGCTGAAGACGTCAAGGCCTACACCGTCGGCCCTCATTACTGCCACGCAGAGACACGCAAG
TCCCCCGTCGTCGATGGTATAGTCAGGCGCAACACGCACGGGAAAGAGTTGCGCTACGTGACTGGTTTGAGCGCT
GAGGAAAAGGACGTTGCCAGCAAGATTTCCACCACCTTTGGTCAACGCGTCTGCGGCTTCGACTTGCTGCGAGCA
TCGGGCAAGAGCTATGTCATCGATGTCAACGGCTGGAGCTTCGTCAAGGACAACGACGACTACTACGATCATTGT
GCGAATATTCTCAAAGACATGTTTGTCAAGGAAAGGCTGCGCAGGGGAGGCGTCACTCCACCGATGCCGTCACCA
GCCTTCTCGGATATTGATCCGCTGGCTCGAGCCGCACAGGCAATGAAGGATCGCGACCAACAGCAGCCACCCGGA
ACCAGCAGCGGCTCTCAATCGGCGTCGAGAGCAGCTAGCGGAACCGGCATGCTTTCTCAGGGGTCGCAGCACACC
GACTCGACCCGGGCTGCAAGCGAGGCGGCTTCCAACAAGGCCGAGAGCGCTCTCAACTCGTCGACGCAAAGCACG
GAAACGAGCCCCGTGCTGCCGCCGCCGCCCCCTGAAGTGACGTCGGCCGGGCCCGTCTCGGCCTCTTCCTCGATC
AGGACCGCGGCCGCTCACGCGTCAAACGCCCAGCCACCGGAAGGAGAGGCCATGGCTGCTCCCCCGCCGCCCCCG
AAGCACTCTTGGAAGCTCAAAGGCATGGTCTGCGTCATACGCCATGCCGATCGCACGCCGAAACAAAAGTACAAG
TTTACGTTTCACACCGAGCCATTCATTGCCCTACTCAAGGGACATCAAGAAGAAGTGCTGCTCATAGGGGAGGCG
GCGCTGGCGAGCGTCATCCAAGCCGTCGACATGGCGCTCGAAGAGGGCATCGAAGACGCAGTCAAACTCAAGGCG
CTGCGCAACGTACTCGTCAAGAAGGGCAGCTGGGCAGGGACCAAGGTGCAGATCAAGCCCATGTTTCGCAACAAA
CCAGAGACTCAACCCGCACCGGATGCGTCTGAGGCAGGTGAGAATGCCAGAGCCGCGAATGCCGAGGGCGAGGAA
GAGGGCGACGGCAACGGCGACGGCGGAGAGGGCGAAGGGCGACGCAAGCCTCCTAAGAGGCAGGATTCCTTATCC
GGCGTCACCATGTCCAAGTTCACAGCGGCCGAGGAACGCTTAGTTCTCGACAAGCTTCAGCTTATCGTCAAATGG
GGCGGCGAACCAACGCACTCGGCGCGATACCAGTCGCAGGAACTCGGTGAGAACATGCGCAACGATCTGATGTTG
CTCAATAGGGACGTGCTCGACGAGGTTCACGTCTTCAGCAGCTCGGAGCGGCGCGTCACTGCCAGCGCTCAGATC
TGGGCCGCCTCGTTCCTGGGTAGAAAGGACATACCCGAGGACTTTATCACGATCCGCAAGAACCTCCTGGACGAC
TCCAACGCGGCCAAGGACGAGACGGACAAGGTCAAGAAGAAGCTCAAGGGCCTCCTCCGCAAGGGAAACGAGCGT
CCCGCACAGTTCGCTTGGCCCGAGAACATGCCGGAGCCGTCCGAGGTGCAGACGAGGGTGGTGCAGCTCATGAAC
TTTCACCGACGCGTCATGCATTACAACTATGGCAAGATCCGGAGCGGCAACGGCACCTCGCTGAGCTCCGTCTCC
AACGCCAGCACGGAAAAGCTGACGGCCGAAGGCTCCAACACATCGCTCTCGTCGGCCGTATCGCACGCCAACAGC
ATCAACGGCATCCAGTCGCGATGGTGTAGCGGTGAGGACGCCGAACTCTTCCGCGAGCGGTGGGAGAAGCTGTTT
ACCGAGTTCTGCGACGGCGACAAGGTGGATCCCAGCAAGATCTCAGAGCTGTACGACACGATGAAGTTTGACGCG
CTTCACAACCGACAGTTCCTCGAATGGGTCTTTACGCCGCCCAAGGCCATGCTGGACGAGGAATACTCGCTCAAG
TCGACGATGGCCGACGAGAACCGGGCGGTCGAGGAGCAGCAAAGGGACGACAAGGGGGACTATGGCCTGGACAGG
ACGGATCCGGGCAGCCGGGGGGCGACGGTCCGGAAGCTCTTCCGCAGACGCTCTTTTCTCAACAACCTGAGACAC
CAGCACGAAGATACGGCGCCCGAGCAGTACTTTCGCCTCTACAAGGGCACGGCGCACAAGACGGCGGCCAAGGTG
GACCCGCGGAACGAGCCGCTGCAGGAGCTGTACAGACTGGCCAAGGTGCTGTTTGACTTTATCTGCCCGCAGGAA
TACGGCATCTCGGACAGCGAGAAGCTCGAGATTGGGCTCCTGACGTCTCTGCCGCTCCTCAAGGAGATTGTGCAG
GACCTGGAGGAGATGCAGGCGTCCAACGATGCCAAATCCTTCTTTTACTTTACCAAGGAATCTCACATCTACACG
CTGCTCAACTGCATCATCGAGGGCGGCATCGAGACCAAGATCAAGCGAAGCACGATTCCTGAACTCGATTACCTG
TCGCAGATTTGCTTTGAGCTGTACGAGTCCGAGGCGAAGCAGGGGCAGCAGCAACAGCAGCAAAAGCAGCAACAA
CAACAACAACAACAGCAACAACAACAACAGGCCGACGAGCCCACCTTTTCCTACAGCATCCGCATCTCCATCAGC
CCCGGGTGTCACGTCTCTGACCCTCTACATGTTCAGCTTGATAGCCGGCATTGCATCGGGTGTGCGCAGAGGCGG
AGTCTCACGCCGCATATAGATTGGCTGCAGGTTGTCAAGACACTGCGAGCCAAGTTTAACCAAGTCAAACTGCCA
AAGACAACGGCAGGCAAACGACCCAGCAGAATCGCTCGAGATGAGATGCCTCCCCCCAAGAGATGGCACAACCCC
GTCCCCGACCCAAGCTGA
Transcript >Ophcf2|02737
ATGATGGACGTCGCCACTCCCGACGACGACTGCCACGATGATGGCTCCACCGGCGCTCCTCCTCCTCCTCCTCCT
TCTCCTCCTCCTCCTTCTCTTCCTCCTCCACCCTGTCAGCGCTCGTCTCGCGCCCGCAGCATCTCTTCCTCTTCG
GCCGCCGGCTCTGTTGCCAGCAGAAAGAGTTGCTACGCTGAACCGGGCCTCTCGCACGTCAACGCTGAACGCACC
AGCGTCGCCTCCGCAACTCCCCACCACTCCCCACTCAGGGCCTCGAGGTCTCGCCGCCCCAATAGCAGCGTCTCG
GACGACTGGAGCGAGGAATCCGTGTCCGCTAGCCCTGACATCGACACGCCTAGACCCCGTCCGCTGTCCACCGTG
GACCTCGCCTCCCTTCCCGAGCCTGCTCTCGCAGCCCGTCCGTCCTTTTCCGAGATTCAGTCGAGGCGTCTGTCG
GCCAACTCGCTTGCTTCGGCCCGCAGCCTTGTCGTCTCGTCTCCGCAGGCCGATATCGGAAACCCGCCGCGTTCC
GTCCCGAGCTACATCATGGCCGCCGGCAAGAGCCCGACATCTTCCTCTGCCGACCCTGGCGCACCCGCCAATTCG
CCCGTCCAGGGGCAGCACCACCTCGCCCAGCCTCTTGACCTCATGCGACGCAACCAGCGTAACGACGCCGCCATA
CGCCCCCAACCTGACCGCTCCCGCAGTAGGGCAAAGAGGAGGTTCAGTGGTAGCACCGCCGCCAGCAGCCACAGC
CCAAGCAGTGATCGTGGTCCCCAGTACCGCGACAAGGAAGAAGCGAAGCCGGCTCCTTGGGGGGTTATTGGTATT
TGCGCCCTTGACGTCAAGGCCAGAAGCAAGCCGAGCAGAAACATCCTCAACCGTCTCATCGCCAATCGCGAATTC
GACGTGGTCGTCTTTGGCGACAAGGTTATTCTCGATGAAGCGGTCGAGAACTGGCCCATGTGTGACTATCTCATA
TCATTCTACTCCGACGGCTTTCCTCTCGACAAGGCCATCGCCTATGTCAAGGCTCGAAAGCCATTCTCCGTCAAC
GATGTCCCCATGCAGCAGGTTCTATGGGACAGGCGAGTCTGTCTTCGTCTCCTCGATAAGATCCAGGTTCGGACC
CCGAAGCGCCTCGAGGTCAGCCGGGATGGCGGCCCCGCGGTTTTGACTCCCGAAATGTCCAAGCACATCAAGGAC
ATCTCTGGAATTTCCCTGACTCCCACGGAATCTCAAGGGGTGCCCGTGCCGCGGCATGTCGAGCTCATGGACGAT
GGCGATGTGCTGAGCGTGGATGGCGCCCTGCTTCGGAAGCCGTTCGTGGAGAAACCAACGAGTGGCGAAGACCAC
AACATCATCATCTACTTCCCCAAGAGCTCGGGCGGTGGTGCGAGGAAGCTCTTCAGGAAGATTGGCAACAAGAGC
TCCGACTATCTGCCTGATCTCAACGTACCGAGAGCCATTTCGGAACCCGGCAGCAGCTACATCTATGAAAGCTTT
ATGAAAGTCGATAATGCTGAAGACGTCAAGGCCTACACCGTCGGCCCTCATTACTGCCACGCAGAGACACGCAAG
TCCCCCGTCGTCGATGGTATAGTCAGGCGCAACACGCACGGGAAAGAGTTGCGCTACGTGACTGGTTTGAGCGCT
GAGGAAAAGGACGTTGCCAGCAAGATTTCCACCACCTTTGGTCAACGCGTCTGCGGCTTCGACTTGCTGCGAGCA
TCGGGCAAGAGCTATGTCATCGATGTCAACGGCTGGAGCTTCGTCAAGGACAACGACGACTACTACGATCATTGT
GCGAATATTCTCAAAGACATGTTTGTCAAGGAAAGGCTGCGCAGGGGAGGCGTCACTCCACCGATGCCGTCACCA
GCCTTCTCGGATATTGATCCGCTGGCTCGAGCCGCACAGGCAATGAAGGATCGCGACCAACAGCAGCCACCCGGA
ACCAGCAGCGGCTCTCAATCGGCGTCGAGAGCAGCTAGCGGAACCGGCATGCTTTCTCAGGGGTCGCAGCACACC
GACTCGACCCGGGCTGCAAGCGAGGCGGCTTCCAACAAGGCCGAGAGCGCTCTCAACTCGTCGACGCAAAGCACG
GAAACGAGCCCCGTGCTGCCGCCGCCGCCCCCTGAAGTGACGTCGGCCGGGCCCGTCTCGGCCTCTTCCTCGATC
AGGACCGCGGCCGCTCACGCGTCAAACGCCCAGCCACCGGAAGGAGAGGCCATGGCTGCTCCCCCGCCGCCCCCG
AAGCACTCTTGGAAGCTCAAAGGCATGGTCTGCGTCATACGCCATGCCGATCGCACGCCGAAACAAAAGTACAAG
TTTACGTTTCACACCGAGCCATTCATTGCCCTACTCAAGGGACATCAAGAAGAAGTGCTGCTCATAGGGGAGGCG
GCGCTGGCGAGCGTCATCCAAGCCGTCGACATGGCGCTCGAAGAGGGCATCGAAGACGCAGTCAAACTCAAGGCG
CTGCGCAACGTACTCGTCAAGAAGGGCAGCTGGGCAGGGACCAAGGTGCAGATCAAGCCCATGTTTCGCAACAAA
CCAGAGACTCAACCCGCACCGGATGCGTCTGAGGCAGGTGAGAATGCCAGAGCCGCGAATGCCGAGGGCGAGGAA
GAGGGCGACGGCAACGGCGACGGCGGAGAGGGCGAAGGGCGACGCAAGCCTCCTAAGAGGCAGGATTCCTTATCC
GGCGTCACCATGTCCAAGTTCACAGCGGCCGAGGAACGCTTAGTTCTCGACAAGCTTCAGCTTATCGTCAAATGG
GGCGGCGAACCAACGCACTCGGCGCGATACCAGTCGCAGGAACTCGGTGAGAACATGCGCAACGATCTGATGTTG
CTCAATAGGGACGTGCTCGACGAGGTTCACGTCTTCAGCAGCTCGGAGCGGCGCGTCACTGCCAGCGCTCAGATC
TGGGCCGCCTCGTTCCTGGGTAGAAAGGACATACCCGAGGACTTTATCACGATCCGCAAGAACCTCCTGGACGAC
TCCAACGCGGCCAAGGACGAGACGGACAAGGTCAAGAAGAAGCTCAAGGGCCTCCTCCGCAAGGGAAACGAGCGT
CCCGCACAGTTCGCTTGGCCCGAGAACATGCCGGAGCCGTCCGAGGTGCAGACGAGGGTGGTGCAGCTCATGAAC
TTTCACCGACGCGTCATGCATTACAACTATGGCAAGATCCGGAGCGGCAACGGCACCTCGCTGAGCTCCGTCTCC
AACGCCAGCACGGAAAAGCTGACGGCCGAAGGCTCCAACACATCGCTCTCGTCGGCCGTATCGCACGCCAACAGC
ATCAACGGCATCCAGTCGCGATGGTGTAGCGGTGAGGACGCCGAACTCTTCCGCGAGCGGTGGGAGAAGCTGTTT
ACCGAGTTCTGCGACGGCGACAAGGTGGATCCCAGCAAGATCTCAGAGCTGTACGACACGATGAAGTTTGACGCG
CTTCACAACCGACAGTTCCTCGAATGGGTCTTTACGCCGCCCAAGGCCATGCTGGACGAGGAATACTCGCTCAAG
TCGACGATGGCCGACGAGAACCGGGCGGTCGAGGAGCAGCAAAGGGACGACAAGGGGGACTATGGCCTGGACAGG
ACGGATCCGGGCAGCCGGGGGGCGACGGTCCGGAAGCTCTTCCGCAGACGCTCTTTTCTCAACAACCTGAGACAC
CAGCACGAAGATACGGCGCCCGAGCAGTACTTTCGCCTCTACAAGGGCACGGCGCACAAGACGGCGGCCAAGGTG
GACCCGCGGAACGAGCCGCTGCAGGAGCTGTACAGACTGGCCAAGGTGCTGTTTGACTTTATCTGCCCGCAGGAA
TACGGCATCTCGGACAGCGAGAAGCTCGAGATTGGGCTCCTGACGTCTCTGCCGCTCCTCAAGGAGATTGTGCAG
GACCTGGAGGAGATGCAGGCGTCCAACGATGCCAAATCCTTCTTTTACTTTACCAAGGAATCTCACATCTACACG
CTGCTCAACTGCATCATCGAGGGCGGCATCGAGACCAAGATCAAGCGAAGCACGATTCCTGAACTCGATTACCTG
TCGCAGATTTGCTTTGAGCTGTACGAGTCCGAGGCGAAGCAGGGGCAGCAGCAACAGCAGCAAAAGCAGCAACAA
CAACAACAACAACAGCAACAACAACAACAGGCCGACGAGCCCACCTTTTCCTACAGCATCCGCATCTCCATCAGC
CCCGGGTGTCACGTCTCTGACCCTCTACATGTTCAGCTTGATAGCCGGCATTGCATCGGGTGTGCGCAGAGGCGG
AGTCTCACGCCGCATATAGATTGGCTGCAGGTTGTCAAGACACTGCGAGCCAAGTTTAACCAAGTCAAACTGCCA
AAGACAACGGCAGGCAAACGACCCAGCAGAATCGCTCGAGATGAGATGCCTCCCCCCAAGAGATGGCACAACCCC
GTCCCCGACCCAAGCTGA
Gene >Ophcf2|02737
ATGATGGACGTCGCCACTCCCGACGACGACTGCCACGATGATGGCTCCACCGGCGCTCCTCCTCCTCCTCCTCCT
TCTCCTCCTCCTCCTTCTCTTCCTCCTCCACCCTGTCAGCGCTCGTCTCGCGCCCGCAGCATCTCTTCCTCTTCG
GCCGCCGGCTCTGTTGCCAGCAGAAAGAGTTGCTACGCTGAACCGGGCCTCTCGCACGTCAACGCTGAACGCACC
AGCGTCGCCTCCGCAACTCCCCACCACTCCCCACTCAGGGCCTCGAGGTCTCGCCGCCCCAATAGCAGCGTCTCG
GACGACTGGAGCGAGGAATCCGTGTCCGCTAGCCCTGACATCGACACGCCTAGACCCCGTCCGCTGTCCACCGTG
GACCTCGCCTCCCTTCCCGAGCCTGCTCTCGCAGCCCGTCCGTCCTTTTCCGAGATTCAGTCGAGGCGTCTGTCG
GCCAACTCGCTTGCTTCGGCCCGCAGCCTTGTCGTCTCGTCTCCGCAGGCCGATATCGGAAACCCGCCGCGTTCC
GTCCCGAGCTACATCATGGCCGCCGGCAAGAGCCCGACATCTTCCTCTGCCGACCCTGGCGCACCCGCCAATTCG
CCCGTCCAGGGGCAGCACCACCTCGCCCAGCCTCTTGACCTCATGCGACGCAACCAGCGTAACGACGCCGCCATA
CGCCCCCAACCTGACCGCTCCCGCAGTAGGGCAAAGAGGAGGTTCAGTGGTAGCACCGCCGCCAGCAGCCACAGC
CCAAGCAGTGATCGTGGTCCCCAGTACCGCGACAAGGAAGAAGGTGAGCCCTGTTCGACATATGACAAGCCGGGC
TCGCATGACAGTCCTGATCCCCTTGTAGCGAAGCCGGCTCCTTGGGGGGTTATTGGTATTTGCGCCCTTGACGTC
AAGGCCAGAAGCAAGCCGAGCAGAAACATCCTCAACCGTCTCATCGCCAATCGCGAATTCGACGTGGTCGTCTTT
GGCGACAAGGTTATTCTCGATGAAGGTTCGTCCGCTTCACATCAGTAATACTGTCAAGATGATGCTGACTGTTGA
TACCCAGCGGTCGAGAACTGGCCCATGTGGTGAGTAACAAGCTCGGTCATTGCAAAAATGTCTTCTGCCTGACCT
AACGCCCCGTAGTGACTATCTCATATCATTCTACTCCGACGGCTTTCCTCTCGACAAGGCCATCGCCTATGTCAA
GGCTCGAAAGCCATTCTCCGTCAACGATGTCCCCATGCAGCAGGTTCTATGGGACAGGCGAGTCTGTCTTCGTCT
CCTCGATAAGATCCAGGTTCGGACCCCGAAGCGCCTCGAGGTCAGCCGGGATGGCGGCCCCGCGGTTTTGACTCC
CGAAATGTCCAAGCACATCAAGGACATCTCTGGAATTTCCCTGACTCCCACGGAATCTCAAGGGGTGCCCGTGCC
GCGGCATGTCGAGCTCATGGACGATGGCGATGTGCTGAGCGTGGATGGCGCCCTGCTTCGGAAGCCGTTCGTGGA
GAAACCAACGAGTGGCGAAGACCACAACATCATCATCTACTTCCCCAAGAGCTCGGGCGGTGGTGCGAGGAAGCT
CTTCAGGAAGATTGGCAACAAGAGCTCCGACTATCTGCCTGATCTCAACGTACCGAGAGCCATTTCGGAACCCGG
CAGCAGCTACATCTATGAAAGCTTTATGAAAGTCGATAATGCTGAAGACGTCAAGGCCTACACCGTCGGCCCTCA
TTACTGCCACGCAGAGACACGCAAGTCCCCCGTCGTCGATGGTATAGTCAGGCGCAACACGCACGGGAAAGAGTT
GCGCTACGTGACTGGTTTGAGCGCTGAGGAAAAGGACGTTGCCAGCAAGATTTCCACCACCTTTGGTCAACGCGT
CTGCGGCTTCGACTTGCTGCGAGCATCGGGCAAGAGCTATGTCATCGATGTCAACGGCTGGAGCTTCGTCAAGGA
CAACGACGACTACTACGATCATTGTGCGAATATTCTCAAAGACATGTTTGTCAAGGAAAGGCTGCGCAGGGGAGG
CGTCACTCCACCGATGCCGTCACCAGCCTTCTCGGATATTGATCCGCTGGCTCGAGCCGCACAGGCAATGAAGGA
TCGCGACCAACAGCAGCCACCCGGAACCAGCAGCGGCTCTCAATCGGCGTCGAGAGCAGCTAGCGGAACCGGCAT
GCTTTCTCAGGGGTCGCAGCACACCGACTCGACCCGGGCTGCAAGCGAGGCGGCTTCCAACAAGGCCGAGAGCGC
TCTCAACTCGTCGACGCAAAGCACGGAAACGAGCCCCGTGCTGCCGCCGCCGCCCCCTGAAGTGACGTCGGCCGG
GCCCGTCTCGGCCTCTTCCTCGATCAGGACCGCGGCCGCTCACGCGTCAAACGCCCAGCCACCGGAAGGAGAGGC
CATGGCTGCTCCCCCGCCGCCCCCGAAGCACTCTTGGAAGCTCAAAGGCATGGTCTGCGTCATACGCCATGCCGA
TCGCACGCCGAAACAAAAGTACAAGTTTACGTTTCACACCGAGCCATTCATTGCCCTACTCAAGGGACATCAAGA
AGAAGTGCTGCTCATAGGGGAGGCGGCGCTGGCGAGCGTCATCCAAGCCGTCGACATGGCGCTCGAAGAGGGCAT
CGAAGACGCAGTCAAACTCAAGGCGCTGCGCAACGTACTCGTCAAGAAGGGCAGCTGGGCAGGGACCAAGGTGCA
GATCAAGCCCATGTTTCGCAACAAACCAGAGACTCAACCCGCACCGGATGCGTCTGAGGCAGGTGAGAATGCCAG
AGCCGCGAATGCCGAGGGCGAGGAAGAGGGCGACGGCAACGGCGACGGCGGAGAGGGCGAAGGGCGACGCAAGCC
TCCTAAGAGGCAGGATTCCTTATCCGGCGTCACCATGTCCAAGTTCACAGCGGCCGAGGAACGCTTAGTTCTCGA
CAAGCTTCAGCTTATCGTCAAATGGGGCGGCGAACCAACGCACTCGGCGCGATACCAGTCGCAGGAACTCGGTGA
GAACATGCGCAACGATCTGATGTTGCTCAATAGGGACGTGCTCGACGAGGTTCACGTCTTCAGCAGCTCGGAGCG
GCGCGTCACTGCCAGCGCTCAGATCTGGGCCGCCTCGTTCCTGGGTAGAAAGGACATACCCGAGGACTTTATCAC
GATCCGCAAGAACCTCCTGGACGACTCCAACGCGGCCAAGGACGAGACGGACAAGGTCAAGAAGAAGCTCAAGGG
CCTCCTCCGCAAGGGAAACGAGCGTCCCGCACAGTTCGCTTGGCCCGAGAACATGCCGGAGCCGTCCGAGGTGCA
GACGAGGGTGGTGCAGCTCATGAACTTTCACCGACGCGTCATGCATTACAACTATGGCAAGATCCGGAGCGGCAA
CGGCACCTCGCTGAGCTCCGTCTCCAACGCCAGCACGGAAAAGCTGACGGCCGAAGGCTCCAACACATCGCTCTC
GTCGGCCGTATCGCACGCCAACAGCATCAACGGCATCCAGTCGCGATGGTGTAGCGGTGAGGACGCCGAACTCTT
CCGCGAGCGGTGGGAGAAGCTGTTTACCGAGTTCTGCGACGGCGACAAGGTGGATCCCAGCAAGATCTCAGAGCT
GTACGACACGATGAAGTTTGACGCGCTTCACAACCGACAGTTCCTCGAATGGGTCTTTACGCCGCCCAAGGCCAT
GCTGGACGAGGAATACTCGCTCAAGTCGACGATGGCCGACGAGAACCGGGCGGTCGAGGAGCAGCAAAGGGACGA
CAAGGGGGACTATGGCCTGGACAGGACGGATCCGGGCAGCCGGGGGGCGACGGTCCGGAAGCTCTTCCGCAGACG
CTCTTTTCTCAACAACCTGAGACACCAGCACGAAGATACGGCGCCCGAGCAGTACTTTCGCCTCTACAAGGGCAC
GGCGCACAAGACGGCGGCCAAGGTGGACCCGCGGAACGAGCCGCTGCAGGAGCTGTACAGACTGGCCAAGGTGCT
GTTTGACTTTATCTGCCCGCAGGAATACGGCATCTCGGACAGCGAGAAGCTCGAGATTGGGCTCCTGACGTCTCT
GCCGCTCCTCAAGGAGATTGTGCAGGACCTGGAGGAGATGCAGGCGTCCAACGATGCCAAATCCTTCTTTTACTT
TACCAAGGAATCTCACATCTACACGCTGCTCAACTGCATCATCGAGGGCGGCATCGAGACCAAGATCAAGCGAAG
CACGATTCCTGAACTCGATTACCTGTCGCAGATTTGCTTTGAGCTGTACGAGTCCGAGGCGAAGCAGGGGCAGCA
GCAACAGCAGCAAAAGCAGCAACAACAACAACAACAACAGCAACAACAACAACAGGCCGACGAGCCCACCTTTTC
CTACAGCATCCGCATCTCCATCAGCCCCGGGTGTCACGTCTCTGACCCTCTACATGTTCAGCTTGATAGCCGGCA
TTGCATCGGGTGTGCGCAGAGGCGGAGTCTCACGCCGCATATAGATTGGCTGCAGGTTGTCAAGACACTGCGAGC
CAAGTTTAACCAGTGAGTCGCGCATCTATATCCATCTTTGTTTCCCCCTTTCCCTTTTCTCTTTAAAAAACCACA
CCACATGCATCCATCCATCTTCTCCCCCTCGTCTATATCCGCATCACCCCAACGTGCCACTAACATGCCAACCAG
AGTCAAACTGCCAAAGACGTTCCTCGCCGTCAACCTCTCGGAAGCCTTCACCTTTGAAGTCCCAGAACGGCAGGC
AAACGACCCAGCAGAATCGCTCGAGATGAGATGCCTCCCCCCAAGAGATGGCACAACCCCGTCCCCGACCCAAGC
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail