Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02729
Gene name
Locationscaffold_02:4520120..4522416
Strand-
Gene length (bp)2296
Transcript length (bp)1152
Coding sequence length (bp)1152
Protein length (aa) 384

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 8.3E-19 14 371

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane Signal peptide|Transmembrane domain 0.0672 0.0547 0.3348 0.6131 0.2502 0.0153 0.4056 0.5431 0.3615 0.052

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 30 52 22
2 59 78 19
3 135 157 22
4 225 247 22
5 267 289 22
6 309 331 22
7 341 363 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.03 0.0 0.16
Alive In ants, during behavior modification 0.30 0.0 0.76
Dead In ants, recently dead 0.05 0.0 0.23

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 1.0 no
Alive Dead 1.0 no
Dead Fungus 1.0 no

Orthologs

Orthofinder run ID4
Orthogroup21
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|781
Ophiocordyceps australis 1348a (Ghana) OphauG2|3621
Ophiocordyceps australis map64 (Brazil) OphauB2|135
Ophiocordyceps australis map64 (Brazil) OphauB2|4856
Ophiocordyceps camponoti-floridani Ophcf2|05528
Ophiocordyceps camponoti-floridani Ophcf2|03539
Ophiocordyceps camponoti-floridani Ophcf2|02729 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00664
Ophiocordyceps camponoti-rufipedis Ophun1|3781
Ophiocordyceps camponoti-rufipedis Ophun1|1856
Ophiocordyceps camponoti-rufipedis Ophun1|435
Ophiocordyceps camponoti-rufipedis Ophun1|607
Ophiocordyceps kimflemingae Ophio5|4168
Ophiocordyceps kimflemingae Ophio5|4169
Ophiocordyceps kimflemingae Ophio5|5392
Ophiocordyceps kimflemingae Ophio5|6880
Ophiocordyceps kimflemingae Ophio5|741
Ophiocordyceps subramaniannii Hirsu2|7470
Ophiocordyceps subramaniannii Hirsu2|7469
Ophiocordyceps subramaniannii Hirsu2|7335
Ophiocordyceps subramaniannii Hirsu2|6881
Ophiocordyceps subramaniannii Hirsu2|6880
Ophiocordyceps subramaniannii Hirsu2|5938
Ophiocordyceps subramaniannii Hirsu2|1965
Ophiocordyceps subramaniannii Hirsu2|9409
Ophiocordyceps subramaniannii Hirsu2|10936

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02729
MTMAVYTALGVQPIFWNQMLRDIRVSQLDLTNGGTVKLGGTAVGCIVFIPFAKKYGRRSAYIFSTALVAAGVWWS
AYMKTTAEVYLTNFVIGLAGAVNQAAVQMSRGTANGIYFIASKTGASLAPMMAGAHAAKAGYRTSYVSLAVCLTL
ITLLFVGTLEETKFVSRDGDGDGKRVGLAETASASEIDRIVAPLRAPFPRYLRLELITETKESLLSIFREPLQTW
WWPHVLFASVVYGMGICWFVVVGTVTAIRFVKEPYGFDSAQVGYMFGASAVGSVLGCLYGGFLTDKSIQWLARRN
GGVFEPEMRFYLLPLPAVTLSVGLVIFGATTDQGAHWFFPALGIVIFSFGFGATADIVCTVVIDSYPDRLAAKDV
PKPPETLR*
Coding >Ophcf2|02729
ATGACAATGGCCGTCTACACGGCACTCGGCGTCCAGCCCATCTTCTGGAACCAGATGCTTAGAGACATACGCGTC
AGCCAACTTGATCTCACAAACGGGGGGACGGTCAAGTTGGGCGGCACGGCTGTAGGATGCATCGTCTTCATCCCC
TTTGCCAAGAAATACGGTCGACGGTCCGCGTACATCTTCTCGACGGCTCTGGTGGCCGCTGGCGTCTGGTGGTCT
GCCTATATGAAGACAACGGCCGAGGTCTATCTAACAAACTTCGTCATCGGTCTGGCCGGAGCGGTCAACCAGGCT
GCTGTGCAGATGAGTAGAGGCACGGCAAACGGCATCTACTTCATAGCCAGCAAGACGGGAGCCTCGCTCGCGCCC
ATGATGGCCGGAGCCCATGCTGCCAAGGCTGGATATAGGACGAGTTACGTCTCGCTGGCCGTTTGCCTCACGCTC
ATCACCTTGCTCTTCGTCGGGACGTTGGAGGAGACGAAATTCGTGTCTCGAGATGGGGATGGTGATGGGAAGAGG
GTTGGATTGGCTGAGACGGCTTCGGCTTCCGAGATTGATCGCATCGTGGCACCTCTACGAGCACCTTTCCCTCGT
TATCTTCGTCTCGAGCTCATCACCGAGACGAAAGAGTCCCTACTAAGCATCTTCCGCGAGCCGCTCCAGACGTGG
TGGTGGCCACACGTGCTCTTCGCGTCCGTCGTCTACGGCATGGGAATCTGCTGGTTTGTCGTCGTCGGGACCGTG
ACAGCCATCCGGTTCGTGAAGGAGCCGTACGGCTTCGACTCGGCGCAGGTGGGATACATGTTTGGAGCGAGCGCC
GTCGGCTCCGTCCTTGGCTGTCTTTACGGCGGTTTCCTCACTGACAAGAGTATTCAGTGGCTGGCTAGACGCAAC
GGGGGCGTGTTTGAGCCTGAGATGCGCTTCTATCTTTTGCCGTTGCCTGCTGTTACCTTGTCTGTTGGGCTGGTC
ATCTTTGGGGCCACGACGGACCAGGGGGCTCACTGGTTCTTCCCTGCTTTGGGAATCGTCATCTTCTCCTTTGGC
TTCGGCGCAACGGCAGATATCGTCTGCACCGTCGTCATCGACTCGTATCCTGACCGCCTTGCCGCAAAGGATGTG
CCGAAGCCACCCGAAACATTGCGCTGA
Transcript >Ophcf2|02729
ATGACAATGGCCGTCTACACGGCACTCGGCGTCCAGCCCATCTTCTGGAACCAGATGCTTAGAGACATACGCGTC
AGCCAACTTGATCTCACAAACGGGGGGACGGTCAAGTTGGGCGGCACGGCTGTAGGATGCATCGTCTTCATCCCC
TTTGCCAAGAAATACGGTCGACGGTCCGCGTACATCTTCTCGACGGCTCTGGTGGCCGCTGGCGTCTGGTGGTCT
GCCTATATGAAGACAACGGCCGAGGTCTATCTAACAAACTTCGTCATCGGTCTGGCCGGAGCGGTCAACCAGGCT
GCTGTGCAGATGAGTAGAGGCACGGCAAACGGCATCTACTTCATAGCCAGCAAGACGGGAGCCTCGCTCGCGCCC
ATGATGGCCGGAGCCCATGCTGCCAAGGCTGGATATAGGACGAGTTACGTCTCGCTGGCCGTTTGCCTCACGCTC
ATCACCTTGCTCTTCGTCGGGACGTTGGAGGAGACGAAATTCGTGTCTCGAGATGGGGATGGTGATGGGAAGAGG
GTTGGATTGGCTGAGACGGCTTCGGCTTCCGAGATTGATCGCATCGTGGCACCTCTACGAGCACCTTTCCCTCGT
TATCTTCGTCTCGAGCTCATCACCGAGACGAAAGAGTCCCTACTAAGCATCTTCCGCGAGCCGCTCCAGACGTGG
TGGTGGCCACACGTGCTCTTCGCGTCCGTCGTCTACGGCATGGGAATCTGCTGGTTTGTCGTCGTCGGGACCGTG
ACAGCCATCCGGTTCGTGAAGGAGCCGTACGGCTTCGACTCGGCGCAGGTGGGATACATGTTTGGAGCGAGCGCC
GTCGGCTCCGTCCTTGGCTGTCTTTACGGCGGTTTCCTCACTGACAAGAGTATTCAGTGGCTGGCTAGACGCAAC
GGGGGCGTGTTTGAGCCTGAGATGCGCTTCTATCTTTTGCCGTTGCCTGCTGTTACCTTGTCTGTTGGGCTGGTC
ATCTTTGGGGCCACGACGGACCAGGGGGCTCACTGGTTCTTCCCTGCTTTGGGAATCGTCATCTTCTCCTTTGGC
TTCGGCGCAACGGCAGATATCGTCTGCACCGTCGTCATCGACTCGTATCCTGACCGCCTTGCCGCAAAGGATGTG
CCGAAGCCACCCGAAACATTGCGCTGA
Gene >Ophcf2|02729
ATGACAATGGCCGTCTACACGGCGTAGGCAAGATAACCCCCCCCCGATTCAATCTCAAGCTGACAGACAGCTCAA
GACTCGGCGTCCAGCCCATCTTCTGGAACCAGATGCTTAGAGACATACGCGTCAGCCAACTTGATCTCACAAACG
GGGGGACGGTCAAGTTGGGCGGCACGGCTGTAGGATGCATCGTCTTCATCCCCTTTGCCAAGAAATACGGTCGAC
GGTCCGCGTACATCTTCTCGACGGCTCTGGTGGCCGCTGGCGTCTGGTGGTCTGCCTATATGAAGACAACGGCCG
AGGTCTATCTAACAAACTTCGTCATCGGTCTGGCCGGAGCGGTCAACCAGGCTGCTGTGCAGATGAGTGTATGTC
TCGATACCCCCTTAGAAGGCCATCTAACCGGCAAAGACGCGAGACATGTTCTTCGTTCACCAGAGAGGCACGGCA
AACGGCATCTACTTCATAGCCAGCAAGACGGGAGCCTCGCTCGCGCCCATGATGGCCGGAGCCCATGCTGCCAAG
GCTGGATATAGGACGAGTTACGTCTCGCTGGCCGTTTGCCTCACGCTCATCACCTTGCTCTTCGTCGGGACGTTG
GAGGAGACGAAATTCGTGTCTCGAGATGGGGATGGTGATGGGAAGAGGGTTGGATTGGCTGAGACGGCTTCGGCT
TCCGAGATTGATCGCATCGTGGCACCTCTACGAGCACCTTTCCCTCGTTATCTTCGTCTCGAGCTCATCACCGAG
ACGAAAGAGTCCCTACTAAGCATCTTCCGCGAGCCGCTCCAGACGTGGTGGTGGCCACACGTGCTCTTCGCGTCC
GTCGTCTACGGCATGGGAATCTGCTGGTTTGTCGTCGTCGGGACCGTGACAGCCATCCGGTTCGTGAAGGAGCCG
TACGGCTTCGACTCGGCGCAGGTGGGATACATGTTTGGAGCGAGCGCCGTCGGCTCCGTCCTTGGCTGTCTTTAC
GGCGGTTTCCTCACTGACAAGAGTATTCAGTGGCTGGCTAGACGCAACGGGGGCGTGTTTGAGCCTGAGATGCGC
TTCTATCTTTTGCCGTTGCCTGCTGTTACCTTGTCTGTTGGGCTGGTCATCTTTGGGGCCACGACGGACCAGGTA
TGCCGTTCTCTCTTAGGGATTCCGGCTGTTGCTGATGATGAGAAATAGGGGGCTCACTGGTTCTTCCCTGCTTTG
GGAATCGTCATCTTCTCCTTTGGCTTCGGCGCAACGGCAGATATCGTCTGCACCGTCGTCATCGACTCGTATCCT
GACGTGAGTTTCCATGTCCCATTTCGATAACATCAACATACGGGTTCTAACTGAAAAGCTGAAGCTTGTTGCTCA
AACTTTCATGGCCGTCGCTTTCTGCCGCAACGCCCTCAGCATGATTGGGCCCGTGTCGATAAGCGGATGGATGGA
AGTGATGAGTATCACAAACATCTTTGTCGTGGCTGCTTTGGTCAGCTTGGCTATTAATTCGACGGGCATTCCGCT
TGTCATCTGGGGGAAGAGGTCGAGGGCTGCCATTGCTCCTAGATACTATAAGCTGGTGGGAGTAGATGTCAGTTC
GTCGGAAATGTCGTCGCGATAAACTCGAGACATGATTGTCAAGAACAGCTGCCAGCATCTACATGTATCCGCCGG
TGAAACATCCGTGTTCAGAGCATCAGCGTGCACACGTGTAGGACAGTAACGCGCCGAGACAAGACGATGGCTGAT
GTAGTGCCGCTCGAGTTGCTGGTTGATGCTTTGAGCGTGCTGAGGATGGCTACGTGTGTTATTCCCACAACGGTC
GTCTTCTACGTGACAGTCGTGAGTTACTCAGAATATACATACCTACCTTTCGGATGGTTCTCCCTTGTAAACTCG
TGTACATCTACAGTGACTTGAGCCCACACGTAGTGTATGTAGTCTCCGCTGTCCTTGACTGCCTCATATAAGGAG
CTAGGTTAGTCTACCTCAATGATGGAAGGGATGAGTGCGTCACACATGGTCATCAACTATGTTGTTAAAGTGGTA
ACCTGCCTGCAAACTTGGATATACTAGACTACTACAACAAACACCATAGAGTAGTGTAGCTGACTGGCATGGAAA
CTTGACAGAATCGAGGACGCTATCGAGGGCATACGGCAACTATCGAAACTACATGTACGAATAGACAAGCCCATT
AACCGTGACAAGGGTCGTGCAATTGATCAGAGTGCAACCGATAACACACGGTGTCTCGGACGTGCTGGAACAGCG
CCTTGCCGCAAAGGATGTGCCGAAGCCACCCGAAACATTGCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail