Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02727
Gene name
Locationscaffold_02:4515436..4518396
Strand+
Gene length (bp)2960
Transcript length (bp)2832
Coding sequence length (bp)2832
Protein length (aa) 944

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13191 AAA_16 AAA ATPase domain 4.9E-09 405 558
PF01048 PNP_UDP_1 Phosphorylase superfamily 5.7E-07 15 305
PF05729 NACHT NACHT domain 1.3E-06 411 605

GO

GO Term Description Terminal node
GO:0009116 nucleoside metabolic process Yes
GO:0003824 catalytic activity Yes
GO:0044281 small molecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:1901657 glycosyl compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:1901135 carbohydrate derivative metabolic process No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6553 0.3644 0.4259 0.0715 0.149 0.0227 0.094 0.0565 0.1987 0.0176

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup47
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5835
Ophiocordyceps australis map64 (Brazil) OphauB2|4118
Ophiocordyceps camponoti-floridani Ophcf2|02727 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6673
Ophiocordyceps camponoti-rufipedis Ophun1|3760
Ophiocordyceps camponoti-rufipedis Ophun1|2945
Ophiocordyceps camponoti-rufipedis Ophun1|2139
Ophiocordyceps camponoti-rufipedis Ophun1|605
Ophiocordyceps kimflemingae Ophio5|7207
Ophiocordyceps kimflemingae Ophio5|7206
Ophiocordyceps kimflemingae Ophio5|7196
Ophiocordyceps kimflemingae Ophio5|1812
Ophiocordyceps kimflemingae Ophio5|2071
Ophiocordyceps kimflemingae Ophio5|6365
Ophiocordyceps subramaniannii Hirsu2|80
Ophiocordyceps subramaniannii Hirsu2|602
Ophiocordyceps subramaniannii Hirsu2|5556
Ophiocordyceps subramaniannii Hirsu2|4178
Ophiocordyceps subramaniannii Hirsu2|2247
Ophiocordyceps subramaniannii Hirsu2|123

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02727
MTTLEDASLYTIGWIAALPIERAAATALLDDRHDPPRGFDQHTSDTNSYTWGRMGAHNIVIASLPAGIYGTTSAA
TTASNLVSSLPQIKIGLLVGIGAGLVRPDSDIRLGDVVVSQPHGTNGGVVQYDLGKAEVDGKWEAKGSLNMPPQV
LLSALANLQAEHEISASNIPELLRKMLTKNPKMGNAGGFVHQGVGKDRLFVSTYAHQQGHTCEACDANQEIKRQK
RSSTDPEIHYGIIASGNKLIKDAVTRDEMAAFLGHDCLCFEMEAAGLMNHFPCLVIRGICDYADSHKNDGWQRYA
SAAAAAYAKELLGFVPVKQLQATRRAVDVLSCIGDQVDKIQAVTTDVRDDVQGVRTVLLDIEQKATLRRLEPRVV
DFHAEDREPTCLAGTRVEILDEISAWATDAEAESIFWLMGTDGTGKSTIARTVARSRDKSLGATFFFKRDDSDRG
NLSRFFSTVAAELTKREPAMASYIHKAALEKSQLYPPTEAAATNTRGIRQGFFRERFNKLILRPLQMVAPALRTD
KPVVLVVDGLDECEPEGDARILIELLLRAVASHSLRLKVLLTSRPKLRARFGMLKNEALNQELVLRRMPTDETDL
LLLVTHELARIRDEFNDSGANHGQLTGDWPGDASIEALVKMAAPVFVSAVTMCRFIADDKMGTPDEQLRKILTPR
RTGEQASSQLDAAYLPVLDNLVENGQRKTQLDGYHNIMGPLVILTTPLSSPSLAHLLDLDQDDVDNLLNALHAVL
HIPPSATDPVSLRHLSFADWILNRKPCPEQAFIIDESKAHGKVAIDCLRVMTRTLKRNMCGTNKGMRANRATIGQ
RRIDACIPHEVQYACVNWVHHVEKAGRDGPSTESIYAFLEAHRLHWMETLGILERGGELVRYVETLQSFMKTQHD
SEGDDASKGQLSELLSSFVPFAAAMGGELDSTPRHVYTARSGA*
Coding >Ophcf2|02727
ATGACGACGTTGGAAGACGCAAGCCTCTACACAATAGGATGGATCGCCGCCCTCCCCATCGAAAGAGCAGCTGCC
ACAGCCCTCCTCGACGACCGCCACGATCCCCCTCGAGGCTTCGACCAGCACACATCCGACACAAACTCGTACACC
TGGGGCCGGATGGGCGCCCACAACATCGTCATCGCCTCTCTTCCAGCCGGAATCTACGGCACCACCTCCGCCGCA
ACAACAGCTTCCAACCTCGTCTCTTCCCTCCCGCAGATCAAGATCGGACTCCTCGTCGGCATCGGCGCCGGCCTT
GTGCGGCCCGACTCGGATATCCGGCTGGGAGACGTCGTCGTCAGCCAACCGCACGGAACGAACGGTGGTGTCGTG
CAGTATGATCTCGGAAAGGCCGAGGTTGATGGCAAGTGGGAGGCAAAGGGGTCCCTTAATATGCCTCCTCAGGTC
CTGCTCAGCGCGCTGGCAAACCTACAAGCTGAACACGAGATATCAGCCTCCAACATACCGGAGCTGCTGCGGAAG
ATGCTGACGAAGAATCCCAAGATGGGTAACGCTGGCGGCTTCGTTCATCAGGGGGTCGGCAAGGATCGACTCTTC
GTATCGACGTATGCCCATCAGCAGGGACACACATGTGAAGCCTGCGACGCGAACCAGGAGATTAAGCGGCAGAAG
CGATCAAGTACAGATCCAGAGATTCACTACGGCATCATCGCCTCTGGAAACAAGCTCATCAAGGACGCCGTCACT
CGCGATGAGATGGCCGCCTTCTTGGGCCATGACTGCCTCTGCTTCGAGATGGAGGCGGCTGGACTGATGAATCAC
TTCCCGTGCCTGGTGATACGAGGCATCTGCGACTACGCCGACTCGCACAAGAACGATGGTTGGCAGCGGTATGCT
TCGGCGGCGGCGGCGGCGTATGCGAAGGAGCTGCTTGGCTTCGTTCCGGTCAAGCAGCTGCAAGCCACGCGGCGG
GCTGTCGATGTGCTTAGCTGCATTGGCGACCAAGTCGACAAGATACAAGCCGTCACGACCGATGTAAGGGATGAC
GTTCAGGGCGTACGAACCGTGCTGCTTGACATCGAGCAGAAAGCCACTCTCCGACGTCTCGAGCCCCGAGTCGTC
GACTTTCATGCCGAGGACAGAGAGCCGACGTGTCTGGCCGGCACTCGAGTCGAAATCTTGGACGAGATATCGGCT
TGGGCCACTGATGCCGAAGCAGAGTCCATCTTCTGGCTGATGGGCACAGATGGGACGGGCAAGTCGACGATAGCC
AGGACCGTCGCCAGGTCTCGGGACAAGAGTCTGGGCGCCACTTTCTTCTTCAAGAGAGACGACTCCGATCGCGGC
AATCTATCCAGGTTCTTCTCTACCGTGGCAGCCGAACTGACGAAACGAGAACCAGCCATGGCGAGCTACATTCAC
AAAGCCGCCTTGGAAAAGTCTCAACTCTACCCGCCGACGGAAGCAGCAGCCACAAACACGAGGGGCATCAGACAA
GGCTTCTTCCGTGAAAGATTCAACAAGCTCATACTGAGACCTCTGCAGATGGTAGCTCCGGCTCTCCGGACGGAC
AAGCCCGTCGTTCTCGTCGTCGACGGCTTGGACGAGTGCGAGCCAGAGGGTGATGCTCGGATCTTGATCGAGCTG
CTCTTGAGAGCCGTGGCTTCCCACTCGTTGAGACTCAAGGTGTTGCTCACCAGCAGGCCGAAGCTACGGGCTCGC
TTCGGCATGTTGAAGAATGAGGCTTTGAATCAGGAGTTGGTTCTTCGTAGGATGCCTACTGATGAGACTGACCTT
TTATTGCTGGTGACGCACGAGCTAGCTAGAATCCGGGACGAGTTTAACGATTCAGGGGCGAATCATGGTCAGCTT
ACTGGTGACTGGCCTGGAGATGCCAGTATCGAAGCACTGGTCAAGATGGCGGCGCCCGTGTTTGTGTCCGCAGTG
ACCATGTGCCGGTTCATCGCGGATGACAAGATGGGAACCCCTGACGAGCAGCTGCGGAAGATTCTCACTCCTCGA
CGGACTGGAGAGCAAGCATCGTCTCAACTGGACGCAGCCTACTTGCCCGTATTAGACAACCTTGTTGAAAACGGT
CAACGGAAGACGCAACTAGATGGTTATCACAACATCATGGGACCACTCGTCATCCTCACGACCCCCTTATCAAGT
CCATCTCTAGCACATCTCCTCGACCTCGACCAAGACGACGTCGACAACTTGTTAAACGCGCTACATGCCGTCCTT
CACATCCCCCCATCGGCAACGGACCCCGTCAGCCTACGACACCTCTCCTTCGCCGACTGGATCCTCAACCGCAAG
CCATGCCCCGAGCAAGCCTTCATCATAGACGAGAGTAAAGCGCACGGAAAGGTAGCGATCGACTGCCTGCGCGTC
ATGACGCGGACGCTCAAGAGAAACATGTGCGGGACTAACAAAGGCATGCGAGCGAATCGAGCGACCATCGGCCAG
CGGAGGATCGACGCCTGCATCCCCCATGAGGTTCAATACGCGTGCGTCAACTGGGTACATCACGTCGAAAAGGCA
GGCCGCGACGGTCCGTCCACCGAGAGTATCTACGCCTTCCTTGAAGCTCATCGGCTACACTGGATGGAGACGCTT
GGCATACTAGAAAGAGGCGGCGAACTCGTCCGCTACGTTGAGACGCTGCAGTCTTTCATGAAGACGCAGCATGAT
TCCGAGGGAGATGATGCGAGTAAAGGGCAGCTTTCCGAGTTGCTATCCAGCTTCGTCCCCTTTGCCGCTGCCATG
GGGGGGGAGCTGGACTCGACACCGCGGCACGTTTACACCGCTCGTTCAGGGGCTTGA
Transcript >Ophcf2|02727
ATGACGACGTTGGAAGACGCAAGCCTCTACACAATAGGATGGATCGCCGCCCTCCCCATCGAAAGAGCAGCTGCC
ACAGCCCTCCTCGACGACCGCCACGATCCCCCTCGAGGCTTCGACCAGCACACATCCGACACAAACTCGTACACC
TGGGGCCGGATGGGCGCCCACAACATCGTCATCGCCTCTCTTCCAGCCGGAATCTACGGCACCACCTCCGCCGCA
ACAACAGCTTCCAACCTCGTCTCTTCCCTCCCGCAGATCAAGATCGGACTCCTCGTCGGCATCGGCGCCGGCCTT
GTGCGGCCCGACTCGGATATCCGGCTGGGAGACGTCGTCGTCAGCCAACCGCACGGAACGAACGGTGGTGTCGTG
CAGTATGATCTCGGAAAGGCCGAGGTTGATGGCAAGTGGGAGGCAAAGGGGTCCCTTAATATGCCTCCTCAGGTC
CTGCTCAGCGCGCTGGCAAACCTACAAGCTGAACACGAGATATCAGCCTCCAACATACCGGAGCTGCTGCGGAAG
ATGCTGACGAAGAATCCCAAGATGGGTAACGCTGGCGGCTTCGTTCATCAGGGGGTCGGCAAGGATCGACTCTTC
GTATCGACGTATGCCCATCAGCAGGGACACACATGTGAAGCCTGCGACGCGAACCAGGAGATTAAGCGGCAGAAG
CGATCAAGTACAGATCCAGAGATTCACTACGGCATCATCGCCTCTGGAAACAAGCTCATCAAGGACGCCGTCACT
CGCGATGAGATGGCCGCCTTCTTGGGCCATGACTGCCTCTGCTTCGAGATGGAGGCGGCTGGACTGATGAATCAC
TTCCCGTGCCTGGTGATACGAGGCATCTGCGACTACGCCGACTCGCACAAGAACGATGGTTGGCAGCGGTATGCT
TCGGCGGCGGCGGCGGCGTATGCGAAGGAGCTGCTTGGCTTCGTTCCGGTCAAGCAGCTGCAAGCCACGCGGCGG
GCTGTCGATGTGCTTAGCTGCATTGGCGACCAAGTCGACAAGATACAAGCCGTCACGACCGATGTAAGGGATGAC
GTTCAGGGCGTACGAACCGTGCTGCTTGACATCGAGCAGAAAGCCACTCTCCGACGTCTCGAGCCCCGAGTCGTC
GACTTTCATGCCGAGGACAGAGAGCCGACGTGTCTGGCCGGCACTCGAGTCGAAATCTTGGACGAGATATCGGCT
TGGGCCACTGATGCCGAAGCAGAGTCCATCTTCTGGCTGATGGGCACAGATGGGACGGGCAAGTCGACGATAGCC
AGGACCGTCGCCAGGTCTCGGGACAAGAGTCTGGGCGCCACTTTCTTCTTCAAGAGAGACGACTCCGATCGCGGC
AATCTATCCAGGTTCTTCTCTACCGTGGCAGCCGAACTGACGAAACGAGAACCAGCCATGGCGAGCTACATTCAC
AAAGCCGCCTTGGAAAAGTCTCAACTCTACCCGCCGACGGAAGCAGCAGCCACAAACACGAGGGGCATCAGACAA
GGCTTCTTCCGTGAAAGATTCAACAAGCTCATACTGAGACCTCTGCAGATGGTAGCTCCGGCTCTCCGGACGGAC
AAGCCCGTCGTTCTCGTCGTCGACGGCTTGGACGAGTGCGAGCCAGAGGGTGATGCTCGGATCTTGATCGAGCTG
CTCTTGAGAGCCGTGGCTTCCCACTCGTTGAGACTCAAGGTGTTGCTCACCAGCAGGCCGAAGCTACGGGCTCGC
TTCGGCATGTTGAAGAATGAGGCTTTGAATCAGGAGTTGGTTCTTCGTAGGATGCCTACTGATGAGACTGACCTT
TTATTGCTGGTGACGCACGAGCTAGCTAGAATCCGGGACGAGTTTAACGATTCAGGGGCGAATCATGGTCAGCTT
ACTGGTGACTGGCCTGGAGATGCCAGTATCGAAGCACTGGTCAAGATGGCGGCGCCCGTGTTTGTGTCCGCAGTG
ACCATGTGCCGGTTCATCGCGGATGACAAGATGGGAACCCCTGACGAGCAGCTGCGGAAGATTCTCACTCCTCGA
CGGACTGGAGAGCAAGCATCGTCTCAACTGGACGCAGCCTACTTGCCCGTATTAGACAACCTTGTTGAAAACGGT
CAACGGAAGACGCAACTAGATGGTTATCACAACATCATGGGACCACTCGTCATCCTCACGACCCCCTTATCAAGT
CCATCTCTAGCACATCTCCTCGACCTCGACCAAGACGACGTCGACAACTTGTTAAACGCGCTACATGCCGTCCTT
CACATCCCCCCATCGGCAACGGACCCCGTCAGCCTACGACACCTCTCCTTCGCCGACTGGATCCTCAACCGCAAG
CCATGCCCCGAGCAAGCCTTCATCATAGACGAGAGTAAAGCGCACGGAAAGGTAGCGATCGACTGCCTGCGCGTC
ATGACGCGGACGCTCAAGAGAAACATGTGCGGGACTAACAAAGGCATGCGAGCGAATCGAGCGACCATCGGCCAG
CGGAGGATCGACGCCTGCATCCCCCATGAGGTTCAATACGCGTGCGTCAACTGGGTACATCACGTCGAAAAGGCA
GGCCGCGACGGTCCGTCCACCGAGAGTATCTACGCCTTCCTTGAAGCTCATCGGCTACACTGGATGGAGACGCTT
GGCATACTAGAAAGAGGCGGCGAACTCGTCCGCTACGTTGAGACGCTGCAGTCTTTCATGAAGACGCAGCATGAT
TCCGAGGGAGATGATGCGAGTAAAGGGCAGCTTTCCGAGTTGCTATCCAGCTTCGTCCCCTTTGCCGCTGCCATG
GGGGGGGAGCTGGACTCGACACCGCGGCACGTTTACACCGCTCGTTCAGGGGCTTGA
Gene >Ophcf2|02727
ATGACGACGTTGGAAGACGCAAGCCTCTACACAATAGGATGGATCGCCGCCCTCCCCATCGAAAGAGCAGCTGCC
ACAGCCCTCCTCGACGACCGCCACGATCCCCCTCGAGGCTTCGACCAGCACACATCCGACACAAACTCGTACACC
TGGGGCCGGATGGGCGCCCACAACATCGTCATCGCCTCTCTTCCAGCCGGAATCTACGGCACCACCTCCGCCGCA
ACAACAGCTTCCAACCTCGTCTCTTCCCTCCCGCAGATCAAGATCGGACTCCTCGTCGGCATCGGCGCCGGCCTT
GTGCGGCCCGACTCGGATATCCGGCTGGGAGACGTCGTCGTCAGCCAACCGCACGGAACGAACGGTGGTGTCGTG
CAGTATGATCTCGGAAAGGCCGAGGTTGATGGCAAGTGGGAGGCAAAGGGGTCCCTTAATATGCCTCCTCAGGTC
CTGCTCAGCGCGCTGGCAAACCTACAAGCTGAACACGAGATATCAGCCTCCAACATACCGGAGCTGCTGCGGAAG
ATGCTGACGAAGAATCCCAAGATGGGTAACGCTGGCGGCTTCGTTCATCAGGGGGTCGGCAAGGATCGACTCTTC
GTATCGACGTATGCCCATCAGCAGGGACACACATGTGAAGCCTGCGACGCGAACCAGGAGATTAAGCGGCAGAAG
CGATCAAGTACAGATCCAGAGATTCACTACGGCATCATCGCCTCTGGAAACAAGCTCATCAAGGACGCCGTCACT
CGCGATGAGATGGCCGCCTTCTTGGGCCATGACTGCCTCTGCTTCGAGATGGAGGCGGCTGGACTGATGAATCAC
TTCCCGTGCCTGGTGATACGAGGCATCTGCGACTACGCCGACTCGCACAAGAACGATGGTTGGCAGCGGTATGCT
TCGGCGGCGGCGGCGGCGTATGCGAAGGAGCTGCTTGGCTTCGTTCCGGTCAAGCAGCTGCAAGCCACGCGGCGG
GCTGTCGATGTGCTTAGCTGCAGTTAGTTGCTTGTCTCCTCGTTGTTCAGGGGGTTGGATGTCTAGTCTAACTGG
AAACATGATGGAAAGTTGGCGACCAAGTCGACAAGATACAAGCCGTCACGACCGATGTAAGGGATGACGTTCAGG
GCGTACGGTGAGTCTGAGTCTATGCTGTCGTGGTCCCCCGCCCTGCCTATAACTGAAGCCGTCACAGAACCGTGC
TGCTTGACATCGAGCAGAAAGCCACTCTCCGACGTCTCGAGCCCCGAGTCGTCGACTTTCATGCCGAGGACAGAG
AGCCGACGTGTCTGGCCGGCACTCGAGTCGAAATCTTGGACGAGATATCGGCTTGGGCCACTGATGCCGAAGCAG
AGTCCATCTTCTGGCTGATGGGCACAGATGGGACGGGCAAGTCGACGATAGCCAGGACCGTCGCCAGGTCTCGGG
ACAAGAGTCTGGGCGCCACTTTCTTCTTCAAGAGAGACGACTCCGATCGCGGCAATCTATCCAGGTTCTTCTCTA
CCGTGGCAGCCGAACTGACGAAACGAGAACCAGCCATGGCGAGCTACATTCACAAAGCCGCCTTGGAAAAGTCTC
AACTCTACCCGCCGACGGAAGCAGCAGCCACAAACACGAGGGGCATCAGACAAGGCTTCTTCCGTGAAAGATTCA
ACAAGCTCATACTGAGACCTCTGCAGATGGTAGCTCCGGCTCTCCGGACGGACAAGCCCGTCGTTCTCGTCGTCG
ACGGCTTGGACGAGTGCGAGCCAGAGGGTGATGCTCGGATCTTGATCGAGCTGCTCTTGAGAGCCGTGGCTTCCC
ACTCGTTGAGACTCAAGGTGTTGCTCACCAGCAGGCCGAAGCTACGGGCTCGCTTCGGCATGTTGAAGAATGAGG
CTTTGAATCAGGAGTTGGTTCTTCGTAGGATGCCTACTGATGAGACTGACCTTTTATTGCTGGTGACGCACGAGC
TAGCTAGAATCCGGGACGAGTTTAACGATTCAGGGGCGAATCATGGTCAGCTTACTGGTGACTGGCCTGGAGATG
CCAGTATCGAAGCACTGGTCAAGATGGCGGCGCCCGTGTTTGTGTCCGCAGTGACCATGTGCCGGTTCATCGCGG
ATGACAAGATGGGAACCCCTGACGAGCAGCTGCGGAAGATTCTCACTCCTCGACGGACTGGAGAGCAAGCATCGT
CTCAACTGGACGCAGCCTACTTGCCCGTATTAGACAACCTTGTTGAAAACGGTCAACGGAAGACGCAACTAGATG
GTTATCACAACATCATGGGACCACTCGTCATCCTCACGACCCCCTTATCAAGTCCATCTCTAGCACATCTCCTCG
ACCTCGACCAAGACGACGTCGACAACTTGTTAAACGCGCTACATGCCGTCCTTCACATCCCCCCATCGGCAACGG
ACCCCGTCAGCCTACGACACCTCTCCTTCGCCGACTGGATCCTCAACCGCAAGCCATGCCCCGAGCAAGCCTTCA
TCATAGACGAGAGTAAAGCGCACGGAAAGGTAGCGATCGACTGCCTGCGCGTCATGACGCGGACGCTCAAGAGAA
ACATGTGCGGGACTAACAAAGGCATGCGAGCGAATCGAGCGACCATCGGCCAGCGGAGGATCGACGCCTGCATCC
CCCATGAGGTTCAATACGCGTGCGTCAACTGGGTACATCACGTCGAAAAGGCAGGCCGCGACGGTCCGTCCACCG
AGAGTATCTACGCCTTCCTTGAAGCTCATCGGCTACACTGGATGGAGACGCTTGGCATACTAGAAAGAGGCGGCG
AACTCGTCCGCTACGTTGAGACGCTGCAGTCTTTCATGAAGACGCAGCATGATTCCGAGGGAGATGATGCGAGTA
AAGGGCAGCTTTCCGAGTTGCTATCCAGCTTCGTCCCCTTTGCCGCTGCCATGGGGGGGGAGCTGGACTCGACAC
CGCGGCACGTTTACACCGCTCGTTCAGGGGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail