Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02725
Gene name
Locationscaffold_02:4510093..4511869
Strand+
Gene length (bp)1776
Transcript length (bp)1776
Coding sequence length (bp)1776
Protein length (aa) 592

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01794 Ferric_reduct Ferric reductase like transmembrane component 3.3E-20 146 266
PF08030 NAD_binding_6 Ferric reductase NAD binding domain 3.2E-09 443 572
PF08022 FAD_binding_8 FAD-binding domain 5.2E-05 322 366

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 30 52 22
2 106 128 22
3 183 205 22
4 220 242 22
5 249 271 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02725
MKTTAEAGAESTILPYYTGLNGVDLTTNTLFAHLLWLTMGVVALAVLGVRLAERLKRRHGRASTTQWRWTPSFKK
HLLYAPLFIKRHNREFRPLPSLNWGTLPSRPYAILLTVYLALNVAALLVLRLNRGNANGYAVMAELRGRSGTLAV
ANMVPLVVLAGRNNPLIRLLGISFDSYNMLHRWLGRLAVVHIVIHVACWMEVASADGGLRHAFALVSRRGGLFLT
SGMAGAMAAVVLLLLSVAPFRHAFYETFLNLHILLALAVLSTTWIHCASAEIDRGLPQLPWIIAIVLIWLMERVA
RVARTVWLHWPKGIASLALCEALPGQITRLTVQLPRFIEVKPGTHAFLRIWGVDFWQSHPFSIAWVHHHHHHHHV
HSPNGRRLLGPYKSSDRSEAVTLLTFLVRARDGATRKLLDEAGRDEKGVRLLVTMEGPYAGSHDLGSYRHLVLIA
ASTGITHQLSYVKPLLEGCNAVRRLLLCWIIRDREWIEWVRPYIDAISRMPGSEHVVSFQVFITRHHGVSVGDTA
TMPLVRLRSGRPDVARLVEDEVSRAGGDMCVSVCGAGALADDVREAVRAVQGRRVVVDFIEECFTW*
Coding >Ophcf2|02725
ATGAAGACGACAGCCGAAGCCGGGGCGGAATCTACCATCCTGCCCTATTACACGGGCTTGAACGGCGTCGACTTG
ACGACGAATACGCTCTTTGCTCATCTTCTCTGGCTGACGATGGGGGTGGTGGCGCTCGCTGTGCTGGGGGTACGA
CTTGCGGAGAGACTGAAGAGGAGACACGGACGAGCATCGACGACGCAATGGCGGTGGACGCCCAGTTTCAAGAAG
CACCTCTTATACGCACCACTCTTCATCAAGCGGCACAATCGCGAGTTTCGACCTCTTCCCAGCCTGAACTGGGGG
ACTCTCCCATCACGGCCATACGCGATACTCCTGACGGTCTACCTGGCGCTCAACGTGGCGGCCTTGCTGGTACTG
CGACTCAACAGGGGGAATGCCAACGGGTACGCCGTCATGGCCGAGCTGAGAGGCCGATCCGGCACGCTGGCCGTT
GCCAACATGGTGCCGCTCGTGGTACTGGCGGGACGAAACAACCCGCTGATCAGGCTGCTGGGCATCAGCTTCGAC
AGCTACAACATGCTTCACCGGTGGCTGGGCAGGCTGGCCGTCGTTCATATCGTCATCCACGTTGCTTGCTGGATG
GAGGTTGCCTCTGCGGATGGGGGCTTGAGGCATGCCTTTGCTCTGGTCAGTCGCAGAGGAGGCCTCTTCCTGACG
TCTGGTATGGCCGGGGCTATGGCGGCTGTCGTGCTGCTGCTGCTCTCCGTTGCTCCCTTTCGCCACGCCTTTTAC
GAGACGTTTCTCAACCTTCATATCCTGCTGGCTCTGGCCGTCTTATCCACTACCTGGATACACTGCGCCTCAGCC
GAGATCGACCGCGGCCTCCCCCAGCTACCGTGGATCATTGCCATTGTCCTCATCTGGCTGATGGAACGCGTAGCT
CGAGTGGCGAGGACCGTCTGGCTTCATTGGCCAAAGGGTATCGCCTCGCTGGCTCTCTGTGAAGCGCTGCCCGGA
CAAATTACACGGCTGACGGTCCAACTACCGCGCTTCATCGAAGTCAAGCCTGGGACACATGCCTTTTTACGAATC
TGGGGCGTCGACTTTTGGCAGAGCCATCCATTCTCCATCGCATGGGTTCATCATCATCATCATCATCATCACGTC
CATAGCCCAAACGGCCGTCGCCTCCTGGGGCCGTACAAGTCGTCGGATCGATCCGAAGCCGTCACCCTGCTGACC
TTTCTCGTCAGGGCCCGCGACGGTGCGACTCGCAAGCTCTTGGACGAGGCTGGCCGGGACGAAAAGGGTGTCAGG
CTGCTCGTTACCATGGAGGGCCCGTACGCGGGCTCTCATGACCTCGGCTCTTATCGACACCTCGTCCTCATCGCC
GCCTCCACCGGAATCACCCATCAGCTCTCCTACGTAAAGCCTCTTCTCGAGGGCTGCAACGCCGTCCGTCGGCTG
TTGCTGTGCTGGATCATTCGCGACAGGGAGTGGATCGAATGGGTGAGGCCTTATATAGATGCCATCTCGCGCATG
CCTGGGAGCGAGCACGTCGTCAGCTTCCAGGTTTTCATCACTCGACATCATGGGGTATCCGTCGGGGACACGGCT
ACCATGCCCCTGGTCCGTCTGCGCTCCGGGAGACCTGACGTGGCGCGTCTGGTGGAAGATGAAGTATCCCGTGCT
GGGGGGGACATGTGTGTCAGTGTGTGCGGAGCTGGAGCCTTGGCAGATGATGTTCGTGAGGCTGTGAGGGCGGTT
CAGGGGCGTCGTGTGGTTGTCGACTTCATAGAGGAGTGTTTTACGTGGTGA
Transcript >Ophcf2|02725
ATGAAGACGACAGCCGAAGCCGGGGCGGAATCTACCATCCTGCCCTATTACACGGGCTTGAACGGCGTCGACTTG
ACGACGAATACGCTCTTTGCTCATCTTCTCTGGCTGACGATGGGGGTGGTGGCGCTCGCTGTGCTGGGGGTACGA
CTTGCGGAGAGACTGAAGAGGAGACACGGACGAGCATCGACGACGCAATGGCGGTGGACGCCCAGTTTCAAGAAG
CACCTCTTATACGCACCACTCTTCATCAAGCGGCACAATCGCGAGTTTCGACCTCTTCCCAGCCTGAACTGGGGG
ACTCTCCCATCACGGCCATACGCGATACTCCTGACGGTCTACCTGGCGCTCAACGTGGCGGCCTTGCTGGTACTG
CGACTCAACAGGGGGAATGCCAACGGGTACGCCGTCATGGCCGAGCTGAGAGGCCGATCCGGCACGCTGGCCGTT
GCCAACATGGTGCCGCTCGTGGTACTGGCGGGACGAAACAACCCGCTGATCAGGCTGCTGGGCATCAGCTTCGAC
AGCTACAACATGCTTCACCGGTGGCTGGGCAGGCTGGCCGTCGTTCATATCGTCATCCACGTTGCTTGCTGGATG
GAGGTTGCCTCTGCGGATGGGGGCTTGAGGCATGCCTTTGCTCTGGTCAGTCGCAGAGGAGGCCTCTTCCTGACG
TCTGGTATGGCCGGGGCTATGGCGGCTGTCGTGCTGCTGCTGCTCTCCGTTGCTCCCTTTCGCCACGCCTTTTAC
GAGACGTTTCTCAACCTTCATATCCTGCTGGCTCTGGCCGTCTTATCCACTACCTGGATACACTGCGCCTCAGCC
GAGATCGACCGCGGCCTCCCCCAGCTACCGTGGATCATTGCCATTGTCCTCATCTGGCTGATGGAACGCGTAGCT
CGAGTGGCGAGGACCGTCTGGCTTCATTGGCCAAAGGGTATCGCCTCGCTGGCTCTCTGTGAAGCGCTGCCCGGA
CAAATTACACGGCTGACGGTCCAACTACCGCGCTTCATCGAAGTCAAGCCTGGGACACATGCCTTTTTACGAATC
TGGGGCGTCGACTTTTGGCAGAGCCATCCATTCTCCATCGCATGGGTTCATCATCATCATCATCATCATCACGTC
CATAGCCCAAACGGCCGTCGCCTCCTGGGGCCGTACAAGTCGTCGGATCGATCCGAAGCCGTCACCCTGCTGACC
TTTCTCGTCAGGGCCCGCGACGGTGCGACTCGCAAGCTCTTGGACGAGGCTGGCCGGGACGAAAAGGGTGTCAGG
CTGCTCGTTACCATGGAGGGCCCGTACGCGGGCTCTCATGACCTCGGCTCTTATCGACACCTCGTCCTCATCGCC
GCCTCCACCGGAATCACCCATCAGCTCTCCTACGTAAAGCCTCTTCTCGAGGGCTGCAACGCCGTCCGTCGGCTG
TTGCTGTGCTGGATCATTCGCGACAGGGAGTGGATCGAATGGGTGAGGCCTTATATAGATGCCATCTCGCGCATG
CCTGGGAGCGAGCACGTCGTCAGCTTCCAGGTTTTCATCACTCGACATCATGGGGTATCCGTCGGGGACACGGCT
ACCATGCCCCTGGTCCGTCTGCGCTCCGGGAGACCTGACGTGGCGCGTCTGGTGGAAGATGAAGTATCCCGTGCT
GGGGGGGACATGTGTGTCAGTGTGTGCGGAGCTGGAGCCTTGGCAGATGATGTTCGTGAGGCTGTGAGGGCGGTT
CAGGGGCGTCGTGTGGTTGTCGACTTCATAGAGGAGTGTTTTACGTGGTGA
Gene >Ophcf2|02725
ATGAAGACGACAGCCGAAGCCGGGGCGGAATCTACCATCCTGCCCTATTACACGGGCTTGAACGGCGTCGACTTG
ACGACGAATACGCTCTTTGCTCATCTTCTCTGGCTGACGATGGGGGTGGTGGCGCTCGCTGTGCTGGGGGTACGA
CTTGCGGAGAGACTGAAGAGGAGACACGGACGAGCATCGACGACGCAATGGCGGTGGACGCCCAGTTTCAAGAAG
CACCTCTTATACGCACCACTCTTCATCAAGCGGCACAATCGCGAGTTTCGACCTCTTCCCAGCCTGAACTGGGGG
ACTCTCCCATCACGGCCATACGCGATACTCCTGACGGTCTACCTGGCGCTCAACGTGGCGGCCTTGCTGGTACTG
CGACTCAACAGGGGGAATGCCAACGGGTACGCCGTCATGGCCGAGCTGAGAGGCCGATCCGGCACGCTGGCCGTT
GCCAACATGGTGCCGCTCGTGGTACTGGCGGGACGAAACAACCCGCTGATCAGGCTGCTGGGCATCAGCTTCGAC
AGCTACAACATGCTTCACCGGTGGCTGGGCAGGCTGGCCGTCGTTCATATCGTCATCCACGTTGCTTGCTGGATG
GAGGTTGCCTCTGCGGATGGGGGCTTGAGGCATGCCTTTGCTCTGGTCAGTCGCAGAGGAGGCCTCTTCCTGACG
TCTGGTATGGCCGGGGCTATGGCGGCTGTCGTGCTGCTGCTGCTCTCCGTTGCTCCCTTTCGCCACGCCTTTTAC
GAGACGTTTCTCAACCTTCATATCCTGCTGGCTCTGGCCGTCTTATCCACTACCTGGATACACTGCGCCTCAGCC
GAGATCGACCGCGGCCTCCCCCAGCTACCGTGGATCATTGCCATTGTCCTCATCTGGCTGATGGAACGCGTAGCT
CGAGTGGCGAGGACCGTCTGGCTTCATTGGCCAAAGGGTATCGCCTCGCTGGCTCTCTGTGAAGCGCTGCCCGGA
CAAATTACACGGCTGACGGTCCAACTACCGCGCTTCATCGAAGTCAAGCCTGGGACACATGCCTTTTTACGAATC
TGGGGCGTCGACTTTTGGCAGAGCCATCCATTCTCCATCGCATGGGTTCATCATCATCATCATCATCATCACGTC
CATAGCCCAAACGGCCGTCGCCTCCTGGGGCCGTACAAGTCGTCGGATCGATCCGAAGCCGTCACCCTGCTGACC
TTTCTCGTCAGGGCCCGCGACGGTGCGACTCGCAAGCTCTTGGACGAGGCTGGCCGGGACGAAAAGGGTGTCAGG
CTGCTCGTTACCATGGAGGGCCCGTACGCGGGCTCTCATGACCTCGGCTCTTATCGACACCTCGTCCTCATCGCC
GCCTCCACCGGAATCACCCATCAGCTCTCCTACGTAAAGCCTCTTCTCGAGGGCTGCAACGCCGTCCGTCGGCTG
TTGCTGTGCTGGATCATTCGCGACAGGGAGTGGATCGAATGGGTGAGGCCTTATATAGATGCCATCTCGCGCATG
CCTGGGAGCGAGCACGTCGTCAGCTTCCAGGTTTTCATCACTCGACATCATGGGGTATCCGTCGGGGACACGGCT
ACCATGCCCCTGGTCCGTCTGCGCTCCGGGAGACCTGACGTGGCGCGTCTGGTGGAAGATGAAGTATCCCGTGCT
GGGGGGGACATGTGTGTCAGTGTGTGCGGAGCTGGAGCCTTGGCAGATGATGTTCGTGAGGCTGTGAGGGCGGTT
CAGGGGCGTCGTGTGGTTGTCGACTTCATAGAGGAGTGTTTTACGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail