Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02724
Gene name
Locationscaffold_02:4507308..4508925
Strand+
Gene length (bp)1617
Transcript length (bp)1326
Coding sequence length (bp)1326
Protein length (aa) 442

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00190 Cupin_1 Cupin 2.1E-18 112 241
PF00190 Cupin_1 Cupin 3.2E-20 285 402
PF07883 Cupin_2 Cupin domain 1.3E-12 136 207
PF07883 Cupin_2 Cupin domain 1.1E-13 315 389
PF05899 Cupin_3 EutQ-like cupin domain 6.9E-06 150 190
PF02311 AraC_binding AraC-like ligand binding domain 1.4E-04 145 198

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0050789 regulation of biological process No
GO:0050794 regulation of cellular process No
GO:0065007 biological regulation No
GO:0080090 regulation of primary metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0010468 regulation of gene expression No
GO:0060255 regulation of macromolecule metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0008150 biological_process No
GO:0051252 regulation of RNA metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0019222 regulation of metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion 0.1948 0.1308 0.4219 0.084 0.6433 0.2598 0.231 0.1391 0.1076 0.3043

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2535
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6704
Ophiocordyceps australis map64 (Brazil) OphauB2|48
Ophiocordyceps camponoti-floridani Ophcf2|02724 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|602
Ophiocordyceps kimflemingae Ophio5|1816
Ophiocordyceps subramaniannii Hirsu2|3726

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02724
MLRYIHSLSACCTKPSSLALLHHEVHRCRRDAQQPLAPYTPGHRDPYDSKIDPVRQKLDPLPWRNGDGASVLGPW
NRDRSRQSPDLVRPPSTDHGAISNMRWSFADSHMRIEEGGWTRQTTVRELPTSVELAGVNMRLDAGTIRELHWHK
EAEWAYVLEGEVRVTAIDYEGGTFMDDLRKGDLWYFPSGVPHSLQGLSENGTEFLLIFDDGHFSEESTFLLTDWL
AHTPLSVVGENFDLDPALFKNLPPREKYIFRGTKPGTIDQERPKGKHVKPSNYQFTHRMLDQTPKNTTGGQVRIT
DSQNFEISKTVAAAHVIIEPGALREMHWHPTADEWSFFIRGRARITVFAAEGNARTFDYQPGDVGIVPRNMGHFV
ENIGDEPVEMLEIFRSDRFRDFSLFQWMGETPRQMVVDHLFQDDEEAGRKFLEKIKDAEKDEVKQT*
Coding >Ophcf2|02724
ATGTTGAGGTACATACATAGTCTATCGGCGTGCTGCACAAAGCCATCATCGCTAGCGCTCCTTCATCATGAAGTC
CACCGCTGCCGTCGTGACGCTCAGCAGCCGCTAGCTCCTTATACCCCAGGCCACCGCGACCCCTACGACAGCAAG
ATCGATCCTGTGCGTCAGAAGCTCGACCCGCTTCCCTGGCGGAACGGAGACGGCGCCTCGGTGCTGGGGCCATGG
AACCGGGACCGCTCGCGGCAGAGCCCGGACCTGGTGCGGCCGCCGAGCACCGATCACGGCGCTATTTCCAATATG
CGATGGAGCTTTGCCGACTCTCACATGCGCATCGAGGAAGGAGGCTGGACTAGGCAGACGACGGTTCGCGAGCTG
CCCACCAGCGTTGAGCTGGCTGGCGTCAATATGCGGCTCGACGCGGGCACTATTCGCGAGCTGCACTGGCACAAG
GAGGCAGAGTGGGCGTACGTTCTCGAAGGCGAGGTTCGCGTGACTGCCATAGACTACGAGGGCGGCACCTTTATG
GATGATCTTCGAAAGGGAGACTTGTGGTATTTCCCCAGCGGCGTGCCTCACTCGCTGCAGGGGCTGAGCGAGAAC
GGCACCGAATTTCTCCTCATCTTTGACGACGGACACTTCTCCGAGGAGTCTACCTTCTTACTGACGGACTGGCTG
GCACATACGCCCCTGTCCGTTGTCGGAGAGAACTTTGATCTCGATCCAGCCTTGTTCAAGAACTTACCCCCCCGT
GAGAAGTACATCTTCCGCGGCACCAAACCCGGAACCATCGATCAAGAGCGACCCAAGGGCAAACACGTCAAGCCG
TCGAATTACCAATTCACTCACCGAATGCTCGACCAGACGCCCAAGAACACGACGGGCGGTCAGGTCCGCATCACC
GACTCGCAGAACTTTGAGATTTCCAAGACGGTGGCCGCGGCGCACGTCATCATAGAGCCGGGAGCGTTGCGCGAG
ATGCATTGGCATCCTACGGCAGACGAGTGGTCCTTTTTCATCCGCGGTCGGGCTCGGATCACCGTCTTCGCTGCC
GAGGGCAACGCCCGCACCTTTGACTACCAGCCAGGCGACGTCGGGATCGTGCCGAGGAACATGGGTCATTTCGTG
GAGAATATCGGCGACGAGCCGGTCGAGATGCTCGAGATCTTTCGCTCCGACCGCTTCCGGGACTTTTCTCTCTTC
CAGTGGATGGGCGAGACGCCGCGTCAGATGGTGGTTGATCACCTCTTCCAAGACGACGAGGAGGCCGGTCGTAAG
TTCTTGGAGAAGATTAAGGACGCGGAGAAGGATGAAGTCAAGCAGACGTGA
Transcript >Ophcf2|02724
ATGTTGAGGTACATACATAGTCTATCGGCGTGCTGCACAAAGCCATCATCGCTAGCGCTCCTTCATCATGAAGTC
CACCGCTGCCGTCGTGACGCTCAGCAGCCGCTAGCTCCTTATACCCCAGGCCACCGCGACCCCTACGACAGCAAG
ATCGATCCTGTGCGTCAGAAGCTCGACCCGCTTCCCTGGCGGAACGGAGACGGCGCCTCGGTGCTGGGGCCATGG
AACCGGGACCGCTCGCGGCAGAGCCCGGACCTGGTGCGGCCGCCGAGCACCGATCACGGCGCTATTTCCAATATG
CGATGGAGCTTTGCCGACTCTCACATGCGCATCGAGGAAGGAGGCTGGACTAGGCAGACGACGGTTCGCGAGCTG
CCCACCAGCGTTGAGCTGGCTGGCGTCAATATGCGGCTCGACGCGGGCACTATTCGCGAGCTGCACTGGCACAAG
GAGGCAGAGTGGGCGTACGTTCTCGAAGGCGAGGTTCGCGTGACTGCCATAGACTACGAGGGCGGCACCTTTATG
GATGATCTTCGAAAGGGAGACTTGTGGTATTTCCCCAGCGGCGTGCCTCACTCGCTGCAGGGGCTGAGCGAGAAC
GGCACCGAATTTCTCCTCATCTTTGACGACGGACACTTCTCCGAGGAGTCTACCTTCTTACTGACGGACTGGCTG
GCACATACGCCCCTGTCCGTTGTCGGAGAGAACTTTGATCTCGATCCAGCCTTGTTCAAGAACTTACCCCCCCGT
GAGAAGTACATCTTCCGCGGCACCAAACCCGGAACCATCGATCAAGAGCGACCCAAGGGCAAACACGTCAAGCCG
TCGAATTACCAATTCACTCACCGAATGCTCGACCAGACGCCCAAGAACACGACGGGCGGTCAGGTCCGCATCACC
GACTCGCAGAACTTTGAGATTTCCAAGACGGTGGCCGCGGCGCACGTCATCATAGAGCCGGGAGCGTTGCGCGAG
ATGCATTGGCATCCTACGGCAGACGAGTGGTCCTTTTTCATCCGCGGTCGGGCTCGGATCACCGTCTTCGCTGCC
GAGGGCAACGCCCGCACCTTTGACTACCAGCCAGGCGACGTCGGGATCGTGCCGAGGAACATGGGTCATTTCGTG
GAGAATATCGGCGACGAGCCGGTCGAGATGCTCGAGATCTTTCGCTCCGACCGCTTCCGGGACTTTTCTCTCTTC
CAGTGGATGGGCGAGACGCCGCGTCAGATGGTGGTTGATCACCTCTTCCAAGACGACGAGGAGGCCGGTCGTAAG
TTCTTGGAGAAGATTAAGGACGCGGAGAAGGATGAAGTCAAGCAGACGTGA
Gene >Ophcf2|02724
ATGTTGGTGAGCTCATGGCTGGTAATTGACTACTTACTTCCCCAGTCACCCTCTTCATTGCAGAGGTACATACAT
AGTCTATCGGCGTGCTGCACAAAGCCATCATCGGTCTGCATCTACTGCCTGTCCCTCTGACGGCCCCGTCTCACC
CAGCTAACCGATTCGCCATGCAGCTAGCGCTCCTTCATCATGAAGTCCACCGCTGTCAGTGGATGGCTTCTGCTA
GCTGTAGCAGGCCAGTCCTCAGCTCTGCCAGGCCGTCGTGACGCTCAGCAGCCGCTAGCTCCTTATACCCCAGGC
CACCGCGACCCCTACGACAGCAAGATCGATCCTGTGCGTCAGAAGCTCGACCCGCTTCCCTGGCGGAACGGAGAC
GGCGCCTCGGTGCTGGGGCCATGGAACCGGGACCGCTCGCGGCAGAGCCCGGACCTGGTGCGGCCGCCGAGCACC
GATCACGGCGCTATTTCCAATATGCGATGGAGCTTTGCCGACTCTCACATGCGCATCGAGGTGAAAACTGGGAAT
CGGAGCGGATAGGTGTCGCAGACACTGATTTATGCCTGCAGGAAGGAGGCTGGACTAGGCAGACGACGGTTCGCG
AGCTGCCCACCAGCGTTGAGCTGGCTGGCGTCAATATGCGGCTCGACGCGGGCACTATTCGCGAGCTGCACTGGC
ACAAGGAGGCAGAGTGGGCGTACGTTCTCGAAGGCGAGGTTCGCGTGACTGCCATAGACTACGAGGGCGGCACCT
TTATGGATGATCTTCGAAAGGGAGACTTGTGGTATTTCCCCAGCGGCGTGCCTCACTCGCTGCAGGGGCTGAGCG
AGAACGGCACCGAATTTCTCCTCATCTTTGACGACGGACACTTCTCCGAGGAGTCTACCTTCTTACTGACGGACT
GGCTGGGTGAGTTGGGCCGGCATCCCCTCCCTTGTTGACTCCCACGCCTCTAACACGACCTCAATAGCACATACG
CCCCTGTCCGTTGTCGGAGAGAACTTTGATCTCGATCCAGCCTTGTTCAAGAACTTACCCCCCCGTGAGAAGTAC
ATCTTCCGCGGCACCAAACCCGGAACCATCGATCAAGAGCGACCCAAGGGCAAACACGTCAAGCCGTCGAATTAC
CAATTCACTCACCGAATGCTCGACCAGACGCCCAAGAACACGACGGGCGGTCAGGTCCGCATCACCGACTCGCAG
AACTTTGAGATTTCCAAGACGGTGGCCGCGGCGCACGTCATCATAGAGCCGGGAGCGTTGCGCGAGATGCATTGG
CATCCTACGGCAGACGAGTGGTCCTTTTTCATCCGCGGTCGGGCTCGGATCACCGTCTTCGCTGCCGAGGGCAAC
GCCCGCACCTTTGACTACCAGCCAGGCGACGTCGGGATCGTGCCGAGGAACATGGGTCATTTCGTGGAGAATATC
GGCGACGAGCCGGTCGAGATGCTCGAGATCTTTCGCTCCGACCGCTTCCGGGACTTTTCTCTCTTCCAGTGGATG
GGCGAGACGCCGCGTCAGATGGTGGTTGATCACCTCTTCCAAGACGACGAGGAGGCCGGTCGTAAGTTCTTGGAG
AAGATTAAGGACGCGGAGAAGGATGAAGTCAAGCAGACGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail