Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02715
Gene name
Locationscaffold_02:4487366..4489079
Strand-
Gene length (bp)1713
Transcript length (bp)1548
Coding sequence length (bp)1548
Protein length (aa) 516

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01417 ENTH ENTH domain 2.5E-45 32 155

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6162 0.3074 0.0292 0.311 0.0443 0.009 0.0723 0.195 0.565 0.0022

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2529
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5327
Ophiocordyceps australis map64 (Brazil) OphauB2|39
Ophiocordyceps camponoti-floridani Ophcf2|02715 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7486
Ophiocordyceps kimflemingae Ophio5|1827
Ophiocordyceps subramaniannii Hirsu2|3713

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02715
MDLNDLKNSVSNLTLYDLKAGFRKAQNAVMNYTEMEAKVREATNNEPWGASSTLMQEIANGTFNYSTLNEIMPMI
YRRFTEKSAEEWRQIYKALQLLEFLIKHGSERVIDDARGHITLLKMLRQFHFIDQNGKDQGVNVRNRAKELAELL
GDVERIRSERKKARATKNKYTGVEGGMSYGGGISSSSRYGGFGSESAGYGGGGGGNASYGGYSGGVYGDGGGFGG
QASDFRDSAGRSDRFEEYDEFDDDERPSKPSKRTGVKKTTTETTAKKKEPEMDLFSFDEAEQSASTAAMPPNGSA
AANEEDEFDDFQSASPSAAFGQPAAAPLTSTASSTAQFAAPQPLSAPQQANLGQMVSTSSISPAPSGPNYAAFAS
PPVQSQPQQQRRQQQSTTAFQPTGPNYFGTVQAKAPTMDTTMKTTTTTTTTTTTVPAPAPTSAMSKLASPTKTSA
GQSSGGGDAFGALWGKASAGIKKTSTAGAGPTMGQLAKEKSSAGIWGPPAAAQAGGSTASGDLLG*
Coding >Ophcf2|02715
ATGGATCTCAACGATCTCAAAAACAGCGTGTCGAACTTGACCTTGTACGATCTCAAGGCCGGCTTTCGCAAAGCT
CAAAATGCCGTCATGAACTACACCGAGATGGAGGCCAAGGTCAGGGAGGCGACGAACAACGAGCCTTGGGGTGCC
TCGTCGACGCTGATGCAGGAGATTGCCAACGGCACATTCAACTATTCGACGCTCAACGAGATCATGCCCATGATA
TATCGACGCTTCACGGAAAAGTCGGCTGAGGAGTGGCGCCAAATCTACAAAGCGTTGCAGTTGCTCGAATTCCTC
ATCAAGCACGGCTCCGAGCGAGTAATCGATGACGCCCGAGGCCACATCACATTGTTGAAGATGTTGCGGCAATTC
CACTTCATCGACCAAAACGGTAAAGATCAGGGCGTCAATGTGCGCAACAGGGCCAAGGAGCTGGCTGAGCTTCTG
GGCGATGTCGAGCGCATCCGTTCCGAGCGTAAGAAGGCTCGGGCCACCAAGAATAAGTACACCGGCGTCGAGGGT
GGCATGTCGTACGGAGGCGGCATCTCGAGCAGCAGCCGCTACGGCGGATTCGGCAGCGAGAGCGCGGGCTACGGC
GGCGGCGGCGGCGGAAACGCCTCGTACGGCGGCTACTCGGGCGGTGTCTATGGCGACGGTGGAGGGTTCGGAGGG
CAGGCGAGCGACTTCCGGGACTCTGCTGGCAGGTCGGATAGGTTCGAGGAGTATGACGAGTTTGACGACGACGAG
AGGCCATCGAAGCCTTCCAAACGGACGGGAGTCAAGAAGACGACGACAGAGACGACGGCCAAGAAGAAGGAGCCG
GAAATGGACCTCTTCTCGTTTGACGAGGCCGAGCAGAGCGCGTCGACGGCCGCGATGCCGCCCAATGGATCGGCC
GCGGCCAACGAGGAGGACGAGTTTGATGATTTCCAGTCGGCGTCTCCGTCGGCGGCGTTCGGACAGCCAGCAGCG
GCGCCACTGACATCGACGGCATCGTCGACGGCGCAGTTTGCGGCGCCGCAGCCACTGTCGGCACCGCAGCAGGCG
AATCTGGGGCAGATGGTTAGCACGTCGTCCATCTCACCGGCCCCGAGCGGTCCCAACTATGCTGCCTTTGCCAGC
CCGCCGGTGCAGTCCCAGCCGCAACAACAGCGGCGGCAGCAGCAGTCGACGACGGCCTTCCAGCCGACGGGCCCC
AACTACTTTGGCACCGTCCAGGCCAAGGCTCCGACGATGGATACGACGATGAAGACGACGACGACGACGACGACG
ACGACGACGACGGTACCTGCCCCAGCTCCGACATCGGCCATGTCGAAGCTCGCATCTCCCACCAAGACCAGCGCG
GGCCAATCATCCGGCGGAGGCGATGCCTTTGGCGCTCTCTGGGGCAAGGCCAGCGCAGGCATCAAGAAGACGAGC
ACAGCAGGGGCCGGTCCTACCATGGGTCAGCTGGCCAAGGAGAAGAGCAGCGCAGGCATCTGGGGTCCTCCCGCG
GCTGCACAGGCCGGCGGTTCGACGGCATCGGGGGATCTGCTTGGATGA
Transcript >Ophcf2|02715
ATGGATCTCAACGATCTCAAAAACAGCGTGTCGAACTTGACCTTGTACGATCTCAAGGCCGGCTTTCGCAAAGCT
CAAAATGCCGTCATGAACTACACCGAGATGGAGGCCAAGGTCAGGGAGGCGACGAACAACGAGCCTTGGGGTGCC
TCGTCGACGCTGATGCAGGAGATTGCCAACGGCACATTCAACTATTCGACGCTCAACGAGATCATGCCCATGATA
TATCGACGCTTCACGGAAAAGTCGGCTGAGGAGTGGCGCCAAATCTACAAAGCGTTGCAGTTGCTCGAATTCCTC
ATCAAGCACGGCTCCGAGCGAGTAATCGATGACGCCCGAGGCCACATCACATTGTTGAAGATGTTGCGGCAATTC
CACTTCATCGACCAAAACGGTAAAGATCAGGGCGTCAATGTGCGCAACAGGGCCAAGGAGCTGGCTGAGCTTCTG
GGCGATGTCGAGCGCATCCGTTCCGAGCGTAAGAAGGCTCGGGCCACCAAGAATAAGTACACCGGCGTCGAGGGT
GGCATGTCGTACGGAGGCGGCATCTCGAGCAGCAGCCGCTACGGCGGATTCGGCAGCGAGAGCGCGGGCTACGGC
GGCGGCGGCGGCGGAAACGCCTCGTACGGCGGCTACTCGGGCGGTGTCTATGGCGACGGTGGAGGGTTCGGAGGG
CAGGCGAGCGACTTCCGGGACTCTGCTGGCAGGTCGGATAGGTTCGAGGAGTATGACGAGTTTGACGACGACGAG
AGGCCATCGAAGCCTTCCAAACGGACGGGAGTCAAGAAGACGACGACAGAGACGACGGCCAAGAAGAAGGAGCCG
GAAATGGACCTCTTCTCGTTTGACGAGGCCGAGCAGAGCGCGTCGACGGCCGCGATGCCGCCCAATGGATCGGCC
GCGGCCAACGAGGAGGACGAGTTTGATGATTTCCAGTCGGCGTCTCCGTCGGCGGCGTTCGGACAGCCAGCAGCG
GCGCCACTGACATCGACGGCATCGTCGACGGCGCAGTTTGCGGCGCCGCAGCCACTGTCGGCACCGCAGCAGGCG
AATCTGGGGCAGATGGTTAGCACGTCGTCCATCTCACCGGCCCCGAGCGGTCCCAACTATGCTGCCTTTGCCAGC
CCGCCGGTGCAGTCCCAGCCGCAACAACAGCGGCGGCAGCAGCAGTCGACGACGGCCTTCCAGCCGACGGGCCCC
AACTACTTTGGCACCGTCCAGGCCAAGGCTCCGACGATGGATACGACGATGAAGACGACGACGACGACGACGACG
ACGACGACGACGGTACCTGCCCCAGCTCCGACATCGGCCATGTCGAAGCTCGCATCTCCCACCAAGACCAGCGCG
GGCCAATCATCCGGCGGAGGCGATGCCTTTGGCGCTCTCTGGGGCAAGGCCAGCGCAGGCATCAAGAAGACGAGC
ACAGCAGGGGCCGGTCCTACCATGGGTCAGCTGGCCAAGGAGAAGAGCAGCGCAGGCATCTGGGGTCCTCCCGCG
GCTGCACAGGCCGGCGGTTCGACGGCATCGGGGGATCTGCTTGGATGA
Gene >Ophcf2|02715
ATGGATCTCAACGATCTCAAAAACAGCGTGTCGAACTTGACCTTGTACGATCTCAAGGCCGGCTTTCGCAAAGCT
CAAAATGGTGCGCTTCCTGGACAGCCAACCGCGCCCGAGTCGTCGCTGACGCCCTCTTGTCCCAGCCGTCATGAA
CTACACCGAGATGGAGGCCAAGGTAGGCTCGCTTCTGCCCGCGCTTCTCAGTTGCCGGCAGGCTGACTCGCCCAA
AGGTCAGGGAGGCGACGAACAACGAGCCTTGGGGTGCCTCGTCGACGCTGATGCAGGAGATTGCCAACGGCACAT
TCAACTAGTTCGCCTGACTATTGACGCGCGAGCCCGTGGCTGCTGCTGACAAGATGTAGTTCGACGCTCAACGAG
ATCATGCCCATGATATATCGACGCTTCACGGAAAAGTCGGCTGAGGAGTGGCGCCAAATCTACAAAGCGTTGCAG
TTGCTCGAATTCCTCATCAAGCACGGCTCCGAGCGAGTAATCGATGACGCCCGAGGCCACATCACATTGTTGAAG
ATGTTGCGGCAATTCCACTTCATCGACCAAAACGGTAAAGATCAGGGCGTCAATGTGCGCAACAGGGCCAAGGAG
CTGGCTGAGCTTCTGGGCGATGTCGAGCGCATCCGTTCCGAGCGTAAGAAGGCTCGGGCCACCAAGAATAAGTAC
ACCGGCGTCGAGGGTGGCATGTCGTACGGAGGCGGCATCTCGAGCAGCAGCCGCTACGGCGGATTCGGCAGCGAG
AGCGCGGGCTACGGCGGCGGCGGCGGCGGAAACGCCTCGTACGGCGGCTACTCGGGCGGTGTCTATGGCGACGGT
GGAGGGTTCGGAGGGCAGGCGAGCGACTTCCGGGACTCTGCTGGCAGGTCGGATAGGTTCGAGGAGTATGACGAG
TTTGACGACGACGAGAGGCCATCGAAGCCTTCCAAACGGACGGGAGTCAAGAAGACGACGACAGAGACGACGGCC
AAGAAGAAGGAGCCGGAAATGGACCTCTTCTCGTTTGACGAGGCCGAGCAGAGCGCGTCGACGGCCGCGATGCCG
CCCAATGGATCGGCCGCGGCCAACGAGGAGGACGAGTTTGATGATTTCCAGTCGGCGTCTCCGTCGGCGGCGTTC
GGACAGCCAGCAGCGGCGCCACTGACATCGACGGCATCGTCGACGGCGCAGTTTGCGGCGCCGCAGCCACTGTCG
GCACCGCAGCAGGCGAATCTGGGGCAGATGGTTAGCACGTCGTCCATCTCACCGGCCCCGAGCGGTCCCAACTAT
GCTGCCTTTGCCAGCCCGCCGGTGCAGTCCCAGCCGCAACAACAGCGGCGGCAGCAGCAGTCGACGACGGCCTTC
CAGCCGACGGGCCCCAACTACTTTGGCACCGTCCAGGCCAAGGCTCCGACGATGGATACGACGATGAAGACGACG
ACGACGACGACGACGACGACGACGACGGTACCTGCCCCAGCTCCGACATCGGCCATGTCGAAGCTCGCATCTCCC
ACCAAGACCAGCGCGGGCCAATCATCCGGCGGAGGCGATGCCTTTGGCGCTCTCTGGGGCAAGGCCAGCGCAGGC
ATCAAGAAGACGAGCACAGCAGGGGCCGGTCCTACCATGGGTCAGCTGGCCAAGGAGAAGAGCAGCGCAGGCATC
TGGGGTCCTCCCGCGGCTGCACAGGCCGGCGGTTCGACGGCATCGGGGGATCTGCTTGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail