Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02708
Gene name
Locationscaffold_02:4473471..4475414
Strand-
Gene length (bp)1943
Transcript length (bp)1770
Coding sequence length (bp)1770
Protein length (aa) 590

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 1.6E-44 82 558
PF07690 MFS_1 Major Facilitator Superfamily 4.7E-16 119 504

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 94 116 22
2 151 170 19
3 180 202 22
4 215 237 22
5 264 286 22
6 348 370 22
7 397 416 19
8 429 446 17
9 456 478 22
10 491 513 22
11 528 547 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 78.85 44.71 113.00
Alive In ants, during behavior modification 11.30 4.82 17.77
Dead In ants, recently dead 11.73 5.21 18.26

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.893813 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02708
MAMASEPSIVVANSNSNNNNNNSNNKNKASVKANKTTGGNSAYHNFHNDFIHVTDVNERRRLALAEVDRAPFGWY
HVRAIAVAGVGFFTDSYDIFTASLLTIMLGIVYYPGVGHLSTSSDDAIKLATSAGTIVGQLGFGCLADIVGRRQM
YGLELFVIIVATIGQALTSGSPSCSIVGLVIFWRVIMGIGIGGDYPLSSIITSEFATTKWRGAMMAAVFAMQGLG
QLGAAMVMLFVTLGFRSQLEVAPDIAHCDGMCRVSVDRMWRILIGFGAVPACIALYFRLTIPETPRYTFDAARDV
EKAPAQVMAYESGARVGEQDAGAGSESSETPKASWSDFFRHYSKLKNFKLILGTAGSWFCLDVAFYGLSLNNGTI
LSVIGYSTKNSNNVYDFLYKTAVGNLIIVLAGAVPGYWVSVFTIDILGRKKIQMGGFIILVAILVSMGFAYNHLS
PEGLLGLYVVAQFFFNFGPNTTTFIVPGEVFPTRYRSTSHGISAAMGKLGSIIGQSAIATLRTHGATKENPSPWM
NHVLQIYALFMLLGCFTTLLIPETARKTLEELNGEDTYAIEAGDTSGDTSPVKPRLTPGSSNAE*
Coding >Ophcf2|02708
ATGGCCATGGCCTCGGAGCCGTCCATCGTCGTCGCCAACAGCAACAGTAACAACAATAACAACAACAGCAACAAC
AAAAATAAGGCGTCCGTCAAGGCCAACAAGACGACGGGCGGTAACAGCGCCTACCACAACTTTCACAACGACTTC
ATCCATGTTACCGACGTCAATGAGCGCCGCCGTCTCGCCCTGGCCGAGGTCGATCGCGCCCCTTTCGGCTGGTAT
CATGTCCGGGCCATTGCCGTCGCCGGCGTCGGCTTCTTCACGGACTCGTACGACATCTTCACGGCCTCGCTGTTG
ACCATTATGCTGGGAATCGTCTACTACCCGGGCGTCGGTCACTTGTCCACCAGCTCTGACGATGCCATCAAGCTC
GCCACCTCGGCCGGCACCATTGTCGGCCAGCTCGGCTTCGGCTGCCTGGCTGACATCGTCGGACGCAGGCAAATG
TACGGGCTTGAGCTCTTCGTCATCATCGTCGCCACCATCGGCCAGGCCTTGACCAGCGGCTCTCCGTCCTGCAGC
ATCGTCGGCCTGGTCATCTTCTGGCGCGTCATCATGGGCATCGGCATCGGCGGCGACTATCCGCTGTCGTCCATC
ATCACCTCAGAATTCGCCACGACCAAGTGGAGAGGCGCCATGATGGCCGCAGTCTTTGCCATGCAGGGTCTCGGC
CAGCTGGGCGCCGCCATGGTCATGCTCTTCGTCACTCTCGGCTTCCGCTCCCAGCTCGAGGTGGCGCCCGACATT
GCTCACTGCGACGGCATGTGCCGGGTCTCCGTCGACAGGATGTGGAGGATACTCATCGGCTTCGGCGCCGTCCCC
GCCTGCATCGCCCTTTACTTCCGTCTCACGATACCCGAAACGCCTCGCTACACCTTTGACGCGGCCCGCGACGTC
GAAAAGGCCCCGGCCCAAGTCATGGCCTACGAGTCCGGTGCGCGCGTCGGCGAGCAAGATGCCGGGGCCGGGTCC
GAGAGTTCCGAGACGCCCAAGGCCAGCTGGTCCGACTTCTTCCGTCACTACTCTAAGCTCAAGAACTTCAAGCTG
ATCCTAGGCACCGCCGGCTCATGGTTCTGCCTCGATGTCGCCTTTTACGGCCTGTCTCTCAACAACGGCACTATC
CTCAGCGTCATCGGCTACTCGACGAAAAACTCCAACAACGTCTACGACTTTCTCTACAAGACGGCCGTTGGAAAC
CTCATCATTGTCCTTGCCGGCGCCGTCCCGGGCTACTGGGTGTCCGTCTTTACCATTGACATCTTGGGTCGTAAG
AAGATACAGATGGGCGGCTTCATCATCCTCGTGGCCATCCTCGTCTCCATGGGTTTCGCCTACAATCACCTCTCG
CCCGAGGGTCTCTTGGGTCTTTACGTCGTTGCCCAGTTCTTCTTCAACTTTGGTCCCAACACGACCACCTTTATC
GTCCCCGGAGAGGTCTTCCCCACCCGCTACCGGTCGACATCGCACGGCATCTCAGCCGCCATGGGCAAGCTCGGG
TCCATCATCGGCCAGTCGGCCATCGCGACGCTCCGAACCCACGGCGCCACCAAGGAAAACCCATCGCCGTGGATG
AACCACGTGCTGCAGATCTACGCTCTCTTCATGCTCCTCGGCTGCTTCACCACGCTGCTCATCCCGGAGACGGCG
CGCAAGACGCTCGAGGAGCTCAATGGCGAGGACACCTATGCCATCGAAGCCGGGGACACATCTGGCGATACCTCG
CCTGTCAAGCCGCGGCTGACTCCCGGCTCGTCCAACGCGGAGTGA
Transcript >Ophcf2|02708
ATGGCCATGGCCTCGGAGCCGTCCATCGTCGTCGCCAACAGCAACAGTAACAACAATAACAACAACAGCAACAAC
AAAAATAAGGCGTCCGTCAAGGCCAACAAGACGACGGGCGGTAACAGCGCCTACCACAACTTTCACAACGACTTC
ATCCATGTTACCGACGTCAATGAGCGCCGCCGTCTCGCCCTGGCCGAGGTCGATCGCGCCCCTTTCGGCTGGTAT
CATGTCCGGGCCATTGCCGTCGCCGGCGTCGGCTTCTTCACGGACTCGTACGACATCTTCACGGCCTCGCTGTTG
ACCATTATGCTGGGAATCGTCTACTACCCGGGCGTCGGTCACTTGTCCACCAGCTCTGACGATGCCATCAAGCTC
GCCACCTCGGCCGGCACCATTGTCGGCCAGCTCGGCTTCGGCTGCCTGGCTGACATCGTCGGACGCAGGCAAATG
TACGGGCTTGAGCTCTTCGTCATCATCGTCGCCACCATCGGCCAGGCCTTGACCAGCGGCTCTCCGTCCTGCAGC
ATCGTCGGCCTGGTCATCTTCTGGCGCGTCATCATGGGCATCGGCATCGGCGGCGACTATCCGCTGTCGTCCATC
ATCACCTCAGAATTCGCCACGACCAAGTGGAGAGGCGCCATGATGGCCGCAGTCTTTGCCATGCAGGGTCTCGGC
CAGCTGGGCGCCGCCATGGTCATGCTCTTCGTCACTCTCGGCTTCCGCTCCCAGCTCGAGGTGGCGCCCGACATT
GCTCACTGCGACGGCATGTGCCGGGTCTCCGTCGACAGGATGTGGAGGATACTCATCGGCTTCGGCGCCGTCCCC
GCCTGCATCGCCCTTTACTTCCGTCTCACGATACCCGAAACGCCTCGCTACACCTTTGACGCGGCCCGCGACGTC
GAAAAGGCCCCGGCCCAAGTCATGGCCTACGAGTCCGGTGCGCGCGTCGGCGAGCAAGATGCCGGGGCCGGGTCC
GAGAGTTCCGAGACGCCCAAGGCCAGCTGGTCCGACTTCTTCCGTCACTACTCTAAGCTCAAGAACTTCAAGCTG
ATCCTAGGCACCGCCGGCTCATGGTTCTGCCTCGATGTCGCCTTTTACGGCCTGTCTCTCAACAACGGCACTATC
CTCAGCGTCATCGGCTACTCGACGAAAAACTCCAACAACGTCTACGACTTTCTCTACAAGACGGCCGTTGGAAAC
CTCATCATTGTCCTTGCCGGCGCCGTCCCGGGCTACTGGGTGTCCGTCTTTACCATTGACATCTTGGGTCGTAAG
AAGATACAGATGGGCGGCTTCATCATCCTCGTGGCCATCCTCGTCTCCATGGGTTTCGCCTACAATCACCTCTCG
CCCGAGGGTCTCTTGGGTCTTTACGTCGTTGCCCAGTTCTTCTTCAACTTTGGTCCCAACACGACCACCTTTATC
GTCCCCGGAGAGGTCTTCCCCACCCGCTACCGGTCGACATCGCACGGCATCTCAGCCGCCATGGGCAAGCTCGGG
TCCATCATCGGCCAGTCGGCCATCGCGACGCTCCGAACCCACGGCGCCACCAAGGAAAACCCATCGCCGTGGATG
AACCACGTGCTGCAGATCTACGCTCTCTTCATGCTCCTCGGCTGCTTCACCACGCTGCTCATCCCGGAGACGGCG
CGCAAGACGCTCGAGGAGCTCAATGGCGAGGACACCTATGCCATCGAAGCCGGGGACACATCTGGCGATACCTCG
CCTGTCAAGCCGCGGCTGACTCCCGGCTCGTCCAACGCGGAGTGA
Gene >Ophcf2|02708
ATGGCCATGGCCTCGGAGCCGTCCATCGTCGTCGCCAACAGCAACAGTAACAACAATAACAACAACAGCAACAAC
AAAAATAAGGCGTCCGTCAAGGCCAACAAGACGACGGGCGGTAACAGCGCCTACCACAACTTTCACAACGACTTC
ATCCATGTTACCGACGTCAATGAGCGCCGCCGTCTCGCCCTGGCCGAGGTCGATCGCGCCCCTTTCGGCTGGTAT
CATGTCCGGGCCATTGCCGTCGCCGGCGTCGGCTTCTTCACGGACTCGTACGACATCTTCACGGCCTCGCTGTTG
ACCATTATGCTGGGAATCGTCTACTACCCGGGCGTCGGTCACTTGTCCACCAGCTCTGACGATGCCATCAAGCTC
GCCACCTCGGCCGGCACCATTGTCGGCCAGCTCGGCTTCGGCTGCCTGGCTGACATCGTCGGACGCAGGCAAATG
TACGGGCTTGAGCTCTTCGTCATCATCGTCGCCACCATCGGCCAGGCCTTGACCAGCGGCTCTCCGTCCTGCAGC
ATCGTCGGCCTGGTCATCTTCTGGCGCGTCATCATGGGCATCGGCATCGGCGGCGACTATCCGCTGTCGTCCATC
ATCACCTCAGAGTCGGTCCTCTCCTCTCCAGTTCTTTCCCCCGGTGACGGTCACTAACCATCGAGCCTCAGATTC
GCCACGACCAAGTGGAGAGGCGCCATGATGGCCGCAGTCTTTGCCATGCAGGGTCTCGGCCAGCTGGGCGCCGCC
ATGGTCATGCTCTTCGTCACTCTCGGCTTCCGCTCCCAGCTCGAGGTGGCGCCCGACATTGCTCACTGCGACGGC
ATGTGCCGGGTCTCCGTCGACAGGATGTGGAGGATACTCATCGGCTTCGGCGCCGTCCCCGCCTGCATCGCCCTT
TACTGTGAGCCGTTCTGCCCTCTGTTACGTTTTTCGAGCCACTGACATGTCGATCCCTACAGTCCGTCTCACGAT
ACCCGAAACGCCTCGCTACACCTTTGACGCGGCCCGCGACGTCGAAAAGGCCCCGGCCCAAGTCATGGCCTACGA
GTCCGGTGCGCGCGTCGGCGAGCAAGATGCCGGGGCCGGGTCCGAGAGTTCCGAGACGCCCAAGGCCAGCTGGTC
CGACTTCTTCCGTCACTACTCTAAGCTCAAGAACTTCAAGCTGATCCTAGGCACCGCCGGCTCATGGTTCTGCCT
CGATGTCGCCTTTTACGGCCTGTCTCTCAACAACGGCACTATCCTCAGCGTCATCGGCTACTCGACGAAAAACTC
CAACAACGTCTACGACTTTCTCTACAAGACGGCCGTTGGAAACCTCATCATTGTCCTTGCCGGCGCCGTCCCGGG
CTACTGGGTGTCCGTCTTTACCATTGACATCTTGGGTCGTAAGAAGATACAGATGGGCGGCTTCATCATCCTCGT
GGCCATCCTCGTCTCCATGGGTTTCGCCTACAATCACCTCTCGCCCGAGGGTCTCTTGGGTCTTTACGTCGTTGC
CCAGTTCTTCTTCAACTTTGGTACGTTTTGCCTCGTTTTCTTTCCCCTCGACAACTGCTGACCAGCAACGTCTAG
GTCCCAACACGACCACCTTTATCGTCCCCGGAGAGGTCTTCCCCACCCGCTACCGGTCGACATCGCACGGCATCT
CAGCCGCCATGGGCAAGCTCGGGTCCATCATCGGCCAGTCGGCCATCGCGACGCTCCGAACCCACGGCGCCACCA
AGGAAAACCCATCGCCGTGGATGAACCACGTGCTGCAGATCTACGCTCTCTTCATGCTCCTCGGCTGCTTCACCA
CGCTGCTCATCCCGGAGACGGCGCGCAAGACGCTCGAGGAGCTCAATGGCGAGGACACCTATGCCATCGAAGCCG
GGGACACATCTGGCGATACCTCGCCTGTCAAGCCGCGGCTGACTCCCGGCTCGTCCAACGCGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail