Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02707
Gene name
Locationscaffold_02:4469614..4472500
Strand+
Gene length (bp)2886
Transcript length (bp)2574
Coding sequence length (bp)2574
Protein length (aa) 858

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00999 Na_H_Exchanger Sodium/hydrogen exchanger family 5.6E-58 56 444

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0015299 solute:proton antiporter activity Yes
GO:0006812 cation transport Yes
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0015298 solute:cation antiporter activity No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0022804 active transmembrane transporter activity No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0015291 secondary active transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0015297 antiporter activity No
GO:0003674 molecular_function No
GO:0006811 ion transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 46 68 22
2 75 97 22
3 112 134 22
4 141 163 22
5 178 200 22
6 212 234 22
7 244 266 22
8 287 309 22
9 333 355 22
10 362 384 22
11 394 416 22
12 429 451 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 18.59 10.09 27.10
Alive In ants, during behavior modification 9.55 4.16 14.93
Dead In ants, recently dead 7.44 3.27 11.61

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.002117 yes
Alive Dead 0.246014 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02707
MSTISSVVSATLSSAAAASTSDNRVPPQGGVLEGANPVHYDPSNPIILFIIQTSLIVIVCHALHWPLSKIRQPRV
IAEVIGGIILGPSVMGRVPGFRAAIFPRESLPNLNLVANLGLVLYLFLIGLETDVRFLLSNWRVATSVAFAGLAL
PFGVGCALAWGVYHAFKDDNGVHPTQFTTYMLFIGIAIAITAFPVLCRILTELKLLDTNVGVITLSAGVANDVVG
WILLALCVALVNAGSGLTALWILLCCVAYMLLLLYAVKPVLIWVLRRTGSIENDPSQSVISLILLIALGSAFFTG
IIGVHPIFGGFMAGLILPRENRFNIRVTEKLEDLIGAIFLPLYFTLSGLNTNLGLLDTGLAWGYVFATTIVALVT
KIMGASVAARLNGLVWRESFTIGVLMSCKGLVELIVLNIGLQANILSTRTFTIFVVMALLTTFLTTPIVSMLYPP
WYQVKIEAWRRGGIDWDTGAPLSPSDSDDSAQKRPVEEMRVGRLLAYLRLDSMPALLNLLPLFGGPAAAPTTKTG
TEGREAPVWVHGTRLLQLTDRDSSVMTVAQVSDFSSHDPVVNTFRTVARLHNLAVSGEVAVMPESRFAEALVGRA
ATLSSDFVVLPWSETGGMGDSPVLSTTTLEDRLTSTYSSFVKSVLDSCRCSVGVFFSRTDAASTTVTAQDSDRIK
LVRRCSTGVLPTGVPTAPMPDKPHHIFLPYFGGEDDGWALRLVLQLCRGSDATASIMRVSASDADASRWSAGGVD
PFDSAQSDLSADAAARISFTTCRGSTTMEELLQMADSETRRPQPELKPSSLVVVGYASGVGLQQGKLAKVTNENL
VGGLGLVAGHLVAGGVQADVLVVRGPRPVEGS*
Coding >Ophcf2|02707
ATGTCTACAATCAGCTCCGTCGTCTCCGCGACTTTGTCTTCCGCCGCAGCCGCCTCTACCTCTGACAATCGCGTC
CCTCCTCAGGGCGGCGTCCTCGAGGGCGCAAATCCCGTCCACTATGACCCGAGCAACCCGATTATTCTCTTCATC
ATTCAGACGAGCTTGATCGTCATCGTCTGCCATGCCCTGCACTGGCCACTGTCCAAGATCCGGCAACCTCGCGTC
ATCGCCGAGGTCATTGGCGGCATCATACTCGGCCCCTCTGTCATGGGCCGCGTCCCGGGCTTCCGGGCTGCCATC
TTCCCCAGAGAGTCGCTGCCTAACCTGAACCTCGTCGCGAACCTAGGTCTTGTCCTCTATCTCTTTCTCATCGGC
CTCGAGACCGACGTCCGCTTCCTCCTCAGCAACTGGCGCGTCGCCACCTCGGTCGCCTTTGCCGGTCTTGCTCTT
CCGTTCGGCGTCGGCTGTGCCCTGGCCTGGGGAGTGTACCATGCCTTCAAGGACGACAATGGCGTTCATCCTACT
CAATTTACGACTTATATGCTCTTCATTGGAATCGCCATTGCCATTACCGCATTCCCCGTCCTCTGCCGCATTTTG
ACGGAGCTGAAGCTTCTCGACACCAACGTCGGTGTCATCACGCTGTCGGCCGGAGTGGCCAACGATGTTGTCGGC
TGGATACTTTTGGCGCTCTGCGTCGCCCTGGTCAACGCGGGCAGCGGGCTTACGGCGCTATGGATCCTCCTTTGC
TGTGTCGCCTACATGCTGCTGCTGCTCTATGCCGTCAAGCCCGTCTTGATATGGGTCCTCCGCCGGACGGGAAGT
ATCGAGAACGACCCGTCACAGAGCGTCATTTCCCTCATCCTCCTCATCGCCTTGGGGTCGGCCTTTTTCACCGGC
ATCATCGGTGTTCATCCCATCTTTGGAGGCTTCATGGCCGGCCTCATCCTGCCGCGCGAAAACAGGTTCAACATT
CGCGTGACGGAAAAGCTCGAGGATCTCATTGGAGCCATCTTCTTGCCTCTATACTTTACCCTCTCCGGCCTCAAC
ACTAATCTCGGTCTCCTCGACACGGGGCTTGCCTGGGGCTACGTCTTCGCCACCACCATTGTCGCGCTCGTGACC
AAGATTATGGGCGCCTCGGTAGCAGCCCGACTAAATGGCTTGGTGTGGCGCGAGTCGTTTACCATTGGTGTGCTC
ATGAGCTGCAAGGGCCTTGTCGAGCTGATTGTACTGAACATCGGCCTCCAAGCCAATATTCTCAGCACCAGAACC
TTTACCATCTTCGTCGTCATGGCGCTGCTCACTACCTTCTTGACAACGCCCATTGTATCGATGCTCTACCCGCCG
TGGTACCAGGTCAAGATTGAGGCCTGGAGACGCGGAGGGATCGACTGGGATACGGGCGCCCCTCTCTCGCCTTCG
GACTCGGACGATTCAGCACAAAAGAGGCCCGTGGAAGAGATGCGGGTCGGCAGGTTGCTCGCCTATCTCCGGCTG
GACAGCATGCCGGCCCTGCTCAACCTCTTACCCTTGTTTGGCGGACCTGCTGCTGCTCCGACGACAAAGACGGGG
ACTGAGGGACGAGAGGCGCCCGTCTGGGTGCACGGCACTCGCCTGCTGCAACTCACGGATCGTGACTCGTCGGTC
ATGACGGTGGCCCAGGTGTCCGACTTTAGCAGCCACGATCCCGTCGTCAACACGTTCCGCACCGTCGCACGCCTG
CATAATCTCGCCGTCTCGGGTGAGGTGGCCGTCATGCCCGAGTCGCGCTTCGCCGAAGCTCTCGTCGGCAGGGCG
GCCACCTTGTCGTCGGACTTTGTGGTGCTCCCGTGGAGCGAGACGGGCGGCATGGGCGACTCGCCTGTCCTTTCT
ACGACGACGCTCGAAGACAGGTTGACTTCGACGTACAGCTCCTTTGTCAAGTCGGTGCTCGACTCGTGCCGCTGC
AGCGTCGGCGTCTTCTTCTCGCGTACCGACGCGGCGAGCACCACCGTGACGGCACAGGATTCGGATCGTATCAAG
CTGGTTCGCAGGTGTTCGACGGGCGTGCTTCCCACCGGAGTCCCGACGGCGCCGATGCCCGACAAGCCTCATCAC
ATCTTCCTGCCCTACTTTGGTGGCGAGGATGACGGATGGGCTCTGCGGCTCGTGCTCCAGCTGTGTCGGGGATCA
GACGCCACGGCATCCATCATGCGCGTCTCTGCTTCTGATGCAGACGCGTCAAGATGGTCAGCCGGCGGCGTGGAT
CCCTTCGACTCCGCGCAGTCGGACCTCTCAGCCGACGCGGCCGCCCGCATCAGCTTCACGACGTGTCGCGGGTCG
ACGACGATGGAGGAGCTCTTGCAGATGGCCGACTCGGAGACGAGACGGCCGCAGCCGGAGCTGAAGCCATCGAGC
CTCGTCGTCGTCGGATACGCAAGCGGCGTGGGCTTACAGCAGGGTAAGCTGGCCAAGGTGACGAACGAGAATCTG
GTCGGCGGTTTGGGGCTGGTGGCGGGTCATCTTGTTGCTGGGGGGGTGCAGGCCGATGTGCTTGTGGTCCGGGGA
CCGAGGCCGGTTGAGGGAAGCTGA
Transcript >Ophcf2|02707
ATGTCTACAATCAGCTCCGTCGTCTCCGCGACTTTGTCTTCCGCCGCAGCCGCCTCTACCTCTGACAATCGCGTC
CCTCCTCAGGGCGGCGTCCTCGAGGGCGCAAATCCCGTCCACTATGACCCGAGCAACCCGATTATTCTCTTCATC
ATTCAGACGAGCTTGATCGTCATCGTCTGCCATGCCCTGCACTGGCCACTGTCCAAGATCCGGCAACCTCGCGTC
ATCGCCGAGGTCATTGGCGGCATCATACTCGGCCCCTCTGTCATGGGCCGCGTCCCGGGCTTCCGGGCTGCCATC
TTCCCCAGAGAGTCGCTGCCTAACCTGAACCTCGTCGCGAACCTAGGTCTTGTCCTCTATCTCTTTCTCATCGGC
CTCGAGACCGACGTCCGCTTCCTCCTCAGCAACTGGCGCGTCGCCACCTCGGTCGCCTTTGCCGGTCTTGCTCTT
CCGTTCGGCGTCGGCTGTGCCCTGGCCTGGGGAGTGTACCATGCCTTCAAGGACGACAATGGCGTTCATCCTACT
CAATTTACGACTTATATGCTCTTCATTGGAATCGCCATTGCCATTACCGCATTCCCCGTCCTCTGCCGCATTTTG
ACGGAGCTGAAGCTTCTCGACACCAACGTCGGTGTCATCACGCTGTCGGCCGGAGTGGCCAACGATGTTGTCGGC
TGGATACTTTTGGCGCTCTGCGTCGCCCTGGTCAACGCGGGCAGCGGGCTTACGGCGCTATGGATCCTCCTTTGC
TGTGTCGCCTACATGCTGCTGCTGCTCTATGCCGTCAAGCCCGTCTTGATATGGGTCCTCCGCCGGACGGGAAGT
ATCGAGAACGACCCGTCACAGAGCGTCATTTCCCTCATCCTCCTCATCGCCTTGGGGTCGGCCTTTTTCACCGGC
ATCATCGGTGTTCATCCCATCTTTGGAGGCTTCATGGCCGGCCTCATCCTGCCGCGCGAAAACAGGTTCAACATT
CGCGTGACGGAAAAGCTCGAGGATCTCATTGGAGCCATCTTCTTGCCTCTATACTTTACCCTCTCCGGCCTCAAC
ACTAATCTCGGTCTCCTCGACACGGGGCTTGCCTGGGGCTACGTCTTCGCCACCACCATTGTCGCGCTCGTGACC
AAGATTATGGGCGCCTCGGTAGCAGCCCGACTAAATGGCTTGGTGTGGCGCGAGTCGTTTACCATTGGTGTGCTC
ATGAGCTGCAAGGGCCTTGTCGAGCTGATTGTACTGAACATCGGCCTCCAAGCCAATATTCTCAGCACCAGAACC
TTTACCATCTTCGTCGTCATGGCGCTGCTCACTACCTTCTTGACAACGCCCATTGTATCGATGCTCTACCCGCCG
TGGTACCAGGTCAAGATTGAGGCCTGGAGACGCGGAGGGATCGACTGGGATACGGGCGCCCCTCTCTCGCCTTCG
GACTCGGACGATTCAGCACAAAAGAGGCCCGTGGAAGAGATGCGGGTCGGCAGGTTGCTCGCCTATCTCCGGCTG
GACAGCATGCCGGCCCTGCTCAACCTCTTACCCTTGTTTGGCGGACCTGCTGCTGCTCCGACGACAAAGACGGGG
ACTGAGGGACGAGAGGCGCCCGTCTGGGTGCACGGCACTCGCCTGCTGCAACTCACGGATCGTGACTCGTCGGTC
ATGACGGTGGCCCAGGTGTCCGACTTTAGCAGCCACGATCCCGTCGTCAACACGTTCCGCACCGTCGCACGCCTG
CATAATCTCGCCGTCTCGGGTGAGGTGGCCGTCATGCCCGAGTCGCGCTTCGCCGAAGCTCTCGTCGGCAGGGCG
GCCACCTTGTCGTCGGACTTTGTGGTGCTCCCGTGGAGCGAGACGGGCGGCATGGGCGACTCGCCTGTCCTTTCT
ACGACGACGCTCGAAGACAGGTTGACTTCGACGTACAGCTCCTTTGTCAAGTCGGTGCTCGACTCGTGCCGCTGC
AGCGTCGGCGTCTTCTTCTCGCGTACCGACGCGGCGAGCACCACCGTGACGGCACAGGATTCGGATCGTATCAAG
CTGGTTCGCAGGTGTTCGACGGGCGTGCTTCCCACCGGAGTCCCGACGGCGCCGATGCCCGACAAGCCTCATCAC
ATCTTCCTGCCCTACTTTGGTGGCGAGGATGACGGATGGGCTCTGCGGCTCGTGCTCCAGCTGTGTCGGGGATCA
GACGCCACGGCATCCATCATGCGCGTCTCTGCTTCTGATGCAGACGCGTCAAGATGGTCAGCCGGCGGCGTGGAT
CCCTTCGACTCCGCGCAGTCGGACCTCTCAGCCGACGCGGCCGCCCGCATCAGCTTCACGACGTGTCGCGGGTCG
ACGACGATGGAGGAGCTCTTGCAGATGGCCGACTCGGAGACGAGACGGCCGCAGCCGGAGCTGAAGCCATCGAGC
CTCGTCGTCGTCGGATACGCAAGCGGCGTGGGCTTACAGCAGGGTAAGCTGGCCAAGGTGACGAACGAGAATCTG
GTCGGCGGTTTGGGGCTGGTGGCGGGTCATCTTGTTGCTGGGGGGGTGCAGGCCGATGTGCTTGTGGTCCGGGGA
CCGAGGCCGGTTGAGGGAAGCTGA
Gene >Ophcf2|02707
ATGTCTACAATCAGCTCCGTCGTCTCCGCGACTTTGTCTTCCGCCGCAGCCGCCTCTACCTCTGACAATCGCGTC
CCTCCTCAGGGCGGCGTCCTCGAGGGCGCAAATCCCGTCCACTATGACCCGAGCAACCCGATTATTCTCTTCATC
ATTCAGGTACCGCGAATGGTCTCTTGCTGCTCCGTCTAGGCTGCTGATTCGATTAGACGAGCTTGATCGTCATCG
TCTGCCATGCCCTGCACTGGCCACTGTCCAAGATCCGGCAACCTCGCGTCATCGCCGAGGTCATTGGCGGCATCA
TACTCGGCCCCTCTGTCATGGGCCGCGTCCCGGGCTTCCGGGCTGCCATCTTCCCCAGAGAGTCGCTGCCTAACC
TGAACCTCGTCGCGAACCTAGGTCTTGTCCTCTATCTCTTTCTCATCGGCCTCGAGACCGACGTCCGCTTCCTCC
TCAGCAACTGGCGCGTCGCCACCTCGGTCGCCTTTGCCGGTCTTGCTCTTCCGTTCGGCGTCGGCTGTGCCCTGG
CCTGGGGAGTGTACCATGCCTTCAAGGACGACAATGGCGTTCATCCTACTCAATTTACGACTTATATGCTCTTCA
TTGGAATCGCCATTGCCATTACCGTGCGTCTTTATTCCTAGAGGCATGAACCGTTTGCTGATTCTTTTCCGCGCA
GGCATTCCCCGTCCTCTGCCGCATTTTGACGGAGCTGAAGCTTCTCGACACCAACGTCGGTGTCATCACGCTGTC
GGCCGGAGTGGCCAACGATGTTGTCGGTCTGCAATCCCTCTCGCGTTGAGTGTCTTCGGAAGTGCCTCTGCCTCG
GCAATGTTGAGGAGACACAAGCTATAGAGAACGAGACTCTTGAAACTACCCATATGCCTTTCTGCACTCACTCAG
ACGCTGATACGAAGCCAACAGGCTGGATACTTTTGGCGCTCTGCGTCGCCCTGGTCAACGCGGGCAGCGGGCTTA
CGGCGCTATGGATCCTCCTTTGCTGTGTCGCCTACATGCTGCTGCTGCTCTATGCCGTCAAGCCCGTCTTGATAT
GGGTCCTCCGCCGGACGGGAAGTATCGAGAACGACCCGTCACAGAGCGTCATTTCCCTCATCCTCCTCATCGCCT
TGGGGTCGGCCTTTTTCACCGGCATCATCGGTGTTCATCCCATCTTTGGAGGCTTCATGGCCGGCCTCATCCTGC
CGCGCGAAAACAGGTTCAACATTCGCGTGACGGAAAAGCTCGAGGATCTCATTGGAGCCATCTTCTTGCCTCTAT
ACTTTACCCTCTCCGGCCTCAACACTAATCTCGGTCTCCTCGACACGGGGCTTGCCTGGGGCTACGTCTTCGCCA
CCACCATTGTCGCGCTCGTGACCAAGATTATGGGCGCCTCGGTAGCAGCCCGACTAAATGGCTTGGTGTGGCGCG
AGTCGTTTACCATTGGTGTGCTCATGAGCTGCAAGGGCCTTGTCGAGCTGATTGTACTGGTGAGTCTCTTTGCCT
CGATATGGGAGATTTCGATGCGGCTGGCTGACATGGACCTCTGCACAGAACATCGGCCTCCAAGCCAATATTCTC
AGCACCAGAACCTTTACCATCTTCGTCGTCATGGCGCTGCTCACTACCTTCTTGACAACGCCCATTGTATCGATG
CTCTACCCGCCGTGGTACCAGGTCAAGATTGAGGCCTGGAGACGCGGAGGGATCGACTGGGATACGGGCGCCCCT
CTCTCGCCTTCGGACTCGGACGATTCAGCACAAAAGAGGCCCGTGGAAGAGATGCGGGTCGGCAGGTTGCTCGCC
TATCTCCGGCTGGACAGCATGCCGGCCCTGCTCAACCTCTTACCCTTGTTTGGCGGACCTGCTGCTGCTCCGACG
ACAAAGACGGGGACTGAGGGACGAGAGGCGCCCGTCTGGGTGCACGGCACTCGCCTGCTGCAACTCACGGATCGT
GACTCGTCGGTCATGACGGTGGCCCAGGTGTCCGACTTTAGCAGCCACGATCCCGTCGTCAACACGTTCCGCACC
GTCGCACGCCTGCATAATCTCGCCGTCTCGGGTGAGGTGGCCGTCATGCCCGAGTCGCGCTTCGCCGAAGCTCTC
GTCGGCAGGGCGGCCACCTTGTCGTCGGACTTTGTGGTGCTCCCGTGGAGCGAGACGGGCGGCATGGGCGACTCG
CCTGTCCTTTCTACGACGACGCTCGAAGACAGGTTGACTTCGACGTACAGCTCCTTTGTCAAGTCGGTGCTCGAC
TCGTGCCGCTGCAGCGTCGGCGTCTTCTTCTCGCGTACCGACGCGGCGAGCACCACCGTGACGGCACAGGATTCG
GATCGTATCAAGCTGGTTCGCAGGTGTTCGACGGGCGTGCTTCCCACCGGAGTCCCGACGGCGCCGATGCCCGAC
AAGCCTCATCACATCTTCCTGCCCTACTTTGGTGGCGAGGATGACGGATGGGCTCTGCGGCTCGTGCTCCAGCTG
TGTCGGGGATCAGACGCCACGGCATCCATCATGCGCGTCTCTGCTTCTGATGCAGACGCGTCAAGATGGTCAGCC
GGCGGCGTGGATCCCTTCGACTCCGCGCAGTCGGACCTCTCAGCCGACGCGGCCGCCCGCATCAGCTTCACGACG
TGTCGCGGGTCGACGACGATGGAGGAGCTCTTGCAGATGGCCGACTCGGAGACGAGACGGCCGCAGCCGGAGCTG
AAGCCATCGAGCCTCGTCGTCGTCGGATACGCAAGCGGCGTGGGCTTACAGCAGGGTAAGCTGGCCAAGGTGACG
AACGAGAATCTGGTCGGCGGTTTGGGGCTGGTGGCGGGTCATCTTGTTGCTGGGGGGGTGCAGGCCGATGTGCTT
GTGGTCCGGGGACCGAGGCCGGTTGAGGGAAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail