Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02700
Gene name
Locationscaffold_02:4455930..4457333
Strand-
Gene length (bp)1403
Transcript length (bp)1233
Coding sequence length (bp)1233
Protein length (aa) 411

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 72 94 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 60.31 33.86 86.76
Alive In ants, during behavior modification 38.66 20.32 57.00
Dead In ants, recently dead 51.05 28.27 73.83

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.021081 yes
Alive Dead 0.112675 no
Dead Fungus 0.425779 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02700
MLRRLPLAALRASVAASTARTTVPSLVSTARTISLRPWKRKATPALPLPVYFPRETWSTRLNYWKAPVVRAILST
FLGLLGFLALISVTLVPLMDWADEEWELLSDAEREAFESDHGDDDAWLFIPFPPFAHFTEVQSPYDMNDPDTRRS
FQEFLDPVLQQKIRSEVYEIIFYAMGRETQISQVLGTRNPRVGRQWLDLTYPFRPPNKEYMAGLFFRSDGIYLGL
QQIDDVEAQILKKTIWPESIALASLTFGTSLVKHYFENFLKHDDTAQASSNKTQPASPVSVSKPTPTKNPDEDAD
APKPSFLSALKPTHLQVLHDSKRPSESVVDPYVRKAMMDGYKKWRACESRVETPLTAGAIAVRGAVEFYGPRFAL
TFHFRGYYDPKPGKWLGLKITLLHLRDRVTGQIVR*
Coding >Ophcf2|02700
ATGCTCCGCCGTCTGCCGCTTGCCGCGCTGCGAGCCTCTGTAGCCGCATCTACAGCGCGCACGACAGTCCCGTCA
TTGGTCTCGACGGCCAGAACCATTTCCTTGCGGCCATGGAAGCGAAAAGCGACACCTGCGCTACCGCTGCCAGTC
TATTTCCCCAGAGAGACTTGGTCAACCCGGTTGAATTACTGGAAAGCTCCTGTCGTACGAGCGATTTTGTCGACT
TTCCTCGGGTTATTGGGCTTCTTGGCCCTAATTTCTGTCACGTTGGTCCCCTTGATGGACTGGGCCGATGAAGAA
TGGGAGCTTCTTAGTGATGCAGAAAGAGAAGCCTTCGAATCGGATCATGGCGATGACGACGCCTGGTTATTCATC
CCTTTTCCCCCTTTCGCACACTTCACCGAGGTTCAGTCGCCATACGACATGAATGACCCCGATACGAGACGGTCT
TTTCAGGAATTTCTCGACCCGGTTCTCCAACAGAAGATACGTTCGGAAGTCTACGAGATCATATTCTATGCCATG
GGGAGAGAAACCCAAATTTCCCAAGTCCTCGGCACCAGAAATCCGCGAGTTGGGAGACAATGGCTGGACCTTACA
TATCCATTTCGTCCCCCTAACAAGGAATACATGGCCGGCCTGTTTTTCAGGAGCGACGGCATCTACTTGGGTCTC
CAGCAGATTGATGATGTGGAAGCTCAGATCCTGAAAAAGACCATTTGGCCTGAATCTATCGCCTTGGCCTCTTTG
ACCTTCGGCACATCCCTCGTCAAGCATTATTTCGAAAACTTTTTGAAACACGACGATACAGCCCAGGCCTCGTCA
AATAAGACGCAGCCCGCGTCACCCGTTTCAGTCTCCAAGCCCACCCCGACCAAAAACCCTGACGAAGATGCAGAC
GCCCCCAAGCCATCCTTCCTTTCCGCCCTCAAACCCACACACCTCCAAGTCCTACACGATTCAAAAAGACCGAGC
GAGTCCGTCGTCGATCCCTACGTACGCAAGGCGATGATGGATGGTTACAAGAAATGGAGGGCTTGCGAGTCTCGA
GTCGAGACACCACTTACCGCGGGCGCCATCGCCGTACGCGGTGCCGTAGAGTTCTATGGCCCTCGGTTCGCCCTC
ACCTTTCATTTTCGAGGTTATTACGATCCGAAGCCGGGGAAGTGGCTCGGGCTCAAGATTACCCTTTTGCACCTG
AGGGATCGCGTCACTGGACAGATAGTCAGGTGA
Transcript >Ophcf2|02700
ATGCTCCGCCGTCTGCCGCTTGCCGCGCTGCGAGCCTCTGTAGCCGCATCTACAGCGCGCACGACAGTCCCGTCA
TTGGTCTCGACGGCCAGAACCATTTCCTTGCGGCCATGGAAGCGAAAAGCGACACCTGCGCTACCGCTGCCAGTC
TATTTCCCCAGAGAGACTTGGTCAACCCGGTTGAATTACTGGAAAGCTCCTGTCGTACGAGCGATTTTGTCGACT
TTCCTCGGGTTATTGGGCTTCTTGGCCCTAATTTCTGTCACGTTGGTCCCCTTGATGGACTGGGCCGATGAAGAA
TGGGAGCTTCTTAGTGATGCAGAAAGAGAAGCCTTCGAATCGGATCATGGCGATGACGACGCCTGGTTATTCATC
CCTTTTCCCCCTTTCGCACACTTCACCGAGGTTCAGTCGCCATACGACATGAATGACCCCGATACGAGACGGTCT
TTTCAGGAATTTCTCGACCCGGTTCTCCAACAGAAGATACGTTCGGAAGTCTACGAGATCATATTCTATGCCATG
GGGAGAGAAACCCAAATTTCCCAAGTCCTCGGCACCAGAAATCCGCGAGTTGGGAGACAATGGCTGGACCTTACA
TATCCATTTCGTCCCCCTAACAAGGAATACATGGCCGGCCTGTTTTTCAGGAGCGACGGCATCTACTTGGGTCTC
CAGCAGATTGATGATGTGGAAGCTCAGATCCTGAAAAAGACCATTTGGCCTGAATCTATCGCCTTGGCCTCTTTG
ACCTTCGGCACATCCCTCGTCAAGCATTATTTCGAAAACTTTTTGAAACACGACGATACAGCCCAGGCCTCGTCA
AATAAGACGCAGCCCGCGTCACCCGTTTCAGTCTCCAAGCCCACCCCGACCAAAAACCCTGACGAAGATGCAGAC
GCCCCCAAGCCATCCTTCCTTTCCGCCCTCAAACCCACACACCTCCAAGTCCTACACGATTCAAAAAGACCGAGC
GAGTCCGTCGTCGATCCCTACGTACGCAAGGCGATGATGGATGGTTACAAGAAATGGAGGGCTTGCGAGTCTCGA
GTCGAGACACCACTTACCGCGGGCGCCATCGCCGTACGCGGTGCCGTAGAGTTCTATGGCCCTCGGTTCGCCCTC
ACCTTTCATTTTCGAGGTTATTACGATCCGAAGCCGGGGAAGTGGCTCGGGCTCAAGATTACCCTTTTGCACCTG
AGGGATCGCGTCACTGGACAGATAGTCAGGTGA
Gene >Ophcf2|02700
ATGCTCCGCCGTCTGCCGCTTGCCGCGCTGCGAGCCTCTGTAGCCGCATCTACAGCGCGCACGACAGTCCCGTCA
TTGGTCTCGACGGCCAGAACCATTTCCTTGCGGCCATGGAAGCGAAAAGCGACACCTGCGCTACCGCTGCCAGTC
TATTTCCCCAGAGAGACTTGGTCAACCCGGTTGAATTACTGGAAAGCTCCTGTCGTGTATGGCGCTCCCCACACC
GGTTCTTGGGAACGAGCATGGTTGCTGACGCCTTCAAGACGAGCGATTTTGTCGACTTTCCTCGGGTTATTGGGC
TTCTTGGCCCTAATTTCTGTCACGTTGGTCCCCTTGATGGACTGGGCCGATGAAGAATGGGAGCTTCTTAGTGAT
GCAGAAAGAGAAGCCTTCGAATCGGATCATGGCGATGACGACGCCTGGTTATTCATCCCTTTTCCCCCTTTCGCA
CACTTCACCGAGGTTCAGTCGCCATACGACATGAATGACCCCGATACGAGACGGTCTTTTCAGGAATTTCTCGAC
CCGGTTCTCCAACAGAAGATACGTTGTATGTTTGCAACAAGCTTTTTGGATGTTCCGCGGTGCTAACGTCCTCGC
AGCGGAAGTCTACGAGATCATATTCTATGCCATGGGGAGAGAAACCCAAATTTCCCAAGTCCTCGGCACCAGAAA
TCCGCGAGTTGGGAGACAATGGCTGGACCTTACATATCCATTTCGTCCCCCTAACAAGGAATACATGGCCGGGTA
AGTTTGAAGCCTCCTTCCAACTCTTCCCTGCCACGAATCGAGCCTGACAACCAGCCAGCCTGTTTTTCAGGAGCG
ACGGCATCTACTTGGGTCTCCAGCAGATTGATGATGTGGAAGCTCAGATCCTGAAAAAGACCATTTGGCCTGAAT
CTATCGCCTTGGCCTCTTTGACCTTCGGCACATCCCTCGTCAAGCATTATTTCGAAAACTTTTTGAAACACGACG
ATACAGCCCAGGCCTCGTCAAATAAGACGCAGCCCGCGTCACCCGTTTCAGTCTCCAAGCCCACCCCGACCAAAA
ACCCTGACGAAGATGCAGACGCCCCCAAGCCATCCTTCCTTTCCGCCCTCAAACCCACACACCTCCAAGTCCTAC
ACGATTCAAAAAGACCGAGCGAGTCCGTCGTCGATCCCTACGTACGCAAGGCGATGATGGATGGTTACAAGAAAT
GGAGGGCTTGCGAGTCTCGAGTCGAGACACCACTTACCGCGGGCGCCATCGCCGTACGCGGTGCCGTAGAGTTCT
ATGGCCCTCGGTTCGCCCTCACCTTTCATTTTCGAGGTTATTACGATCCGAAGCCGGGGAAGTGGCTCGGGCTCA
AGATTACCCTTTTGCACCTGAGGGATCGCGTCACTGGACAGATAGTCAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail