Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02691
Gene name
Locationscaffold_02:4440245..4441743
Strand+
Gene length (bp)1498
Transcript length (bp)1368
Coding sequence length (bp)1368
Protein length (aa) 456

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 9.2E-10 38 96

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 105 127 22
2 142 159 17
3 187 209 22
4 219 241 22
5 271 293 22
6 303 322 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 23.99 11.93 36.06
Alive In ants, during behavior modification 46.23 25.54 66.91
Dead In ants, recently dead 27.88 14.22 41.55

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000851 yes
Alive Dead 0.003436 yes
Dead Fungus 0.535687 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02691
MRLAILAVVVGLAAATDDWLWPRASNDSNAIAEMLPLYPVCAQPCIETALANSPCSETRCICMDQGFRGEVRNCV
KASCRIRDAMQSKNTTEHACQRPRRDKTSSFTAMSVSIAAVAYVIVAARLIFKQFFSQRRRLGVDDWLVFAGAVA
GICCTVINVRGLSQHGIGKDVWTLQAETVSSFKLDFYLVALFYIIMTIVAKAAINFFYLSIFPGERTRLVLWVTA
AVIISFGTASLLVSIFQCRPVSFYWKMYHPDQDLNGGSCINIHVAAFANGGINIGLNVWLIVIPLTVIRKLELHW
KKKLGVTIMFLTGVFDTVVSILRLRSIVHFGNSWNPTWDQFDIAWWSVIETNVALICSSLPTMRLILVLVFPHVF
STIRNKTNSTSSSSTVPRKNGSVDKNVPRMTTMSLEIIEAQNVPRDECEDDDEVANNSDEKSSEAKDRRDSLSIG
IAITK*
Coding >Ophcf2|02691
ATGAGGTTGGCAATCCTGGCCGTCGTCGTCGGATTGGCCGCCGCCACGGACGACTGGCTGTGGCCGAGGGCCTCC
AACGACAGCAATGCCATCGCCGAGATGCTGCCTCTGTATCCGGTTTGCGCGCAACCTTGTATCGAGACGGCATTG
GCCAACAGTCCCTGTTCGGAGACGAGGTGTATCTGTATGGATCAGGGGTTTCGAGGCGAGGTGCGGAATTGTGTC
AAGGCCTCTTGCAGGATTCGCGATGCGATGCAGTCCAAGAACACGACCGAACATGCCTGCCAACGCCCCCGTCGC
GACAAAACGTCGTCCTTTACAGCAATGAGCGTCTCCATCGCGGCCGTCGCCTACGTCATCGTTGCCGCCCGTCTC
ATCTTCAAGCAATTCTTCAGTCAGAGGCGACGACTCGGTGTCGACGACTGGCTCGTCTTCGCCGGAGCCGTGGCG
GGAATCTGCTGCACCGTCATCAACGTCCGGGGCCTGAGTCAACATGGAATCGGAAAGGACGTCTGGACGCTGCAG
GCTGAGACGGTGTCCAGCTTCAAGCTGGATTTCTATCTGGTAGCCTTGTTCTACATCATCATGACCATTGTTGCC
AAGGCTGCCATCAACTTCTTTTACCTCTCCATCTTTCCCGGGGAGCGGACGAGGCTGGTTCTCTGGGTTACGGCC
GCCGTCATCATCAGCTTTGGCACGGCTTCTCTTCTCGTCAGCATCTTTCAGTGTCGGCCCGTCTCCTTTTACTGG
AAGATGTATCACCCTGACCAAGATCTCAATGGCGGATCATGCATCAACATCCACGTCGCCGCCTTTGCCAACGGC
GGCATCAACATCGGGCTCAACGTCTGGCTCATCGTCATCCCGCTGACCGTCATCCGCAAGCTAGAGCTCCACTGG
AAGAAGAAGCTGGGCGTGACCATCATGTTCCTAACAGGCGTCTTCGACACCGTCGTCTCCATACTGCGACTGCGA
TCCATCGTCCACTTCGGCAACTCGTGGAATCCGACGTGGGATCAGTTCGATATCGCCTGGTGGTCCGTCATCGAG
ACCAACGTCGCCCTCATCTGCTCCAGTCTTCCGACCATGCGTCTCATCCTCGTCTTGGTCTTCCCGCATGTGTTT
AGCACGATTCGCAACAAGACGAACTCGACGTCTTCGTCTTCTACCGTTCCTCGAAAGAACGGTTCCGTCGATAAG
AATGTTCCTCGCATGACGACGATGAGTCTTGAAATCATTGAAGCTCAGAACGTACCGCGAGACGAATGTGAAGAC
GACGACGAAGTTGCCAACAACAGCGATGAGAAATCAAGCGAAGCCAAGGATCGAAGAGACTCGTTATCCATCGGA
ATCGCCATCACGAAATAA
Transcript >Ophcf2|02691
ATGAGGTTGGCAATCCTGGCCGTCGTCGTCGGATTGGCCGCCGCCACGGACGACTGGCTGTGGCCGAGGGCCTCC
AACGACAGCAATGCCATCGCCGAGATGCTGCCTCTGTATCCGGTTTGCGCGCAACCTTGTATCGAGACGGCATTG
GCCAACAGTCCCTGTTCGGAGACGAGGTGTATCTGTATGGATCAGGGGTTTCGAGGCGAGGTGCGGAATTGTGTC
AAGGCCTCTTGCAGGATTCGCGATGCGATGCAGTCCAAGAACACGACCGAACATGCCTGCCAACGCCCCCGTCGC
GACAAAACGTCGTCCTTTACAGCAATGAGCGTCTCCATCGCGGCCGTCGCCTACGTCATCGTTGCCGCCCGTCTC
ATCTTCAAGCAATTCTTCAGTCAGAGGCGACGACTCGGTGTCGACGACTGGCTCGTCTTCGCCGGAGCCGTGGCG
GGAATCTGCTGCACCGTCATCAACGTCCGGGGCCTGAGTCAACATGGAATCGGAAAGGACGTCTGGACGCTGCAG
GCTGAGACGGTGTCCAGCTTCAAGCTGGATTTCTATCTGGTAGCCTTGTTCTACATCATCATGACCATTGTTGCC
AAGGCTGCCATCAACTTCTTTTACCTCTCCATCTTTCCCGGGGAGCGGACGAGGCTGGTTCTCTGGGTTACGGCC
GCCGTCATCATCAGCTTTGGCACGGCTTCTCTTCTCGTCAGCATCTTTCAGTGTCGGCCCGTCTCCTTTTACTGG
AAGATGTATCACCCTGACCAAGATCTCAATGGCGGATCATGCATCAACATCCACGTCGCCGCCTTTGCCAACGGC
GGCATCAACATCGGGCTCAACGTCTGGCTCATCGTCATCCCGCTGACCGTCATCCGCAAGCTAGAGCTCCACTGG
AAGAAGAAGCTGGGCGTGACCATCATGTTCCTAACAGGCGTCTTCGACACCGTCGTCTCCATACTGCGACTGCGA
TCCATCGTCCACTTCGGCAACTCGTGGAATCCGACGTGGGATCAGTTCGATATCGCCTGGTGGTCCGTCATCGAG
ACCAACGTCGCCCTCATCTGCTCCAGTCTTCCGACCATGCGTCTCATCCTCGTCTTGGTCTTCCCGCATGTGTTT
AGCACGATTCGCAACAAGACGAACTCGACGTCTTCGTCTTCTACCGTTCCTCGAAAGAACGGTTCCGTCGATAAG
AATGTTCCTCGCATGACGACGATGAGTCTTGAAATCATTGAAGCTCAGAACGTACCGCGAGACGAATGTGAAGAC
GACGACGAAGTTGCCAACAACAGCGATGAGAAATCAAGCGAAGCCAAGGATCGAAGAGACTCGTTATCCATCGGA
ATCGCCATCACGAAATAA
Gene >Ophcf2|02691
ATGAGGTTGGCAATCCTGGCCGTCGTCGTCGGATTGGCCGCCGCCACGGACGACTGGCTGTGGCCGAGGGCCTCC
AACGACAGCAATGCCATCGCCGAGATGCTGCCTCTGTATCCGGTTTGCGCGGTAAGACGACGAGGCCTGGCCGTG
CTTCCAAGAGGGGAGTTTTACTGACCGACGAGGTTGTTGCCAGCAACCTTGTATCGAGACGGCATTGGCCAACAG
TCCCTGTTCGGAGACGAGGTGTATCTGTATGGATCAGGGGTTTCGAGGCGAGGTGCGGAATTGTGTCAAGGCCTC
TTGCAGGATTCGCGATGCGATGCGTGAGTTTGGACGGGTTTCCCCGGCATCTACGCCTTGAACCTTGACTGAAGA
TGGAGATGCAGAGTCCAAGAACACGACCGAACATGCCTGCCAACGCCCCCGTCGCGACAAAACGTCGTCCTTTAC
AGCAATGAGCGTCTCCATCGCGGCCGTCGCCTACGTCATCGTTGCCGCCCGTCTCATCTTCAAGCAATTCTTCAG
TCAGAGGCGACGACTCGGTGTCGACGACTGGCTCGTCTTCGCCGGAGCCGTGGCGGGAATCTGCTGCACCGTCAT
CAACGTCCGGGGCCTGAGTCAACATGGAATCGGAAAGGACGTCTGGACGCTGCAGGCTGAGACGGTGTCCAGCTT
CAAGCTGGATTTCTATCTGGTAGCCTTGTTCTACATCATCATGACCATTGTTGCCAAGGCTGCCATCAACTTCTT
TTACCTCTCCATCTTTCCCGGGGAGCGGACGAGGCTGGTTCTCTGGGTTACGGCCGCCGTCATCATCAGCTTTGG
CACGGCTTCTCTTCTCGTCAGCATCTTTCAGTGTCGGCCCGTCTCCTTTTACTGGAAGATGTATCACCCTGACCA
AGATCTCAATGGCGGATCATGCATCAACATCCACGTCGCCGCCTTTGCCAACGGCGGCATCAACATCGGGCTCAA
CGTCTGGCTCATCGTCATCCCGCTGACCGTCATCCGCAAGCTAGAGCTCCACTGGAAGAAGAAGCTGGGCGTGAC
CATCATGTTCCTAACAGGCGTCTTCGACACCGTCGTCTCCATACTGCGACTGCGATCCATCGTCCACTTCGGCAA
CTCGTGGAATCCGACGTGGGATCAGTTCGATATCGCCTGGTGGTCCGTCATCGAGACCAACGTCGCCCTCATCTG
CTCCAGTCTTCCGACCATGCGTCTCATCCTCGTCTTGGTCTTCCCGCATGTGTTTAGCACGATTCGCAACAAGAC
GAACTCGACGTCTTCGTCTTCTACCGTTCCTCGAAAGAACGGTTCCGTCGATAAGAATGTTCCTCGCATGACGAC
GATGAGTCTTGAAATCATTGAAGCTCAGAACGTACCGCGAGACGAATGTGAAGACGACGACGAAGTTGCCAACAA
CAGCGATGAGAAATCAAGCGAAGCCAAGGATCGAAGAGACTCGTTATCCATCGGAATCGCCATCACGAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail