Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02691
Gene name
Locationscaffold_02:4440245..4441743
Strand+
Gene length (bp)1498
Transcript length (bp)1368
Coding sequence length (bp)1368
Protein length (aa) 456

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 9.2E-10 38 96

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane Signal peptide|Transmembrane domain 0.1049 0.0564 0.1692 0.7424 0.0334 0.006 0.0851 0.2594 0.2348 0.0387

SignalP

SignalP signal predicted Location Score
Yes 1 - 15 0.999727

Transmembrane Domains

Domain # Start End Length
1 105 127 22
2 142 159 17
3 187 209 22
4 219 241 22
5 271 293 22
6 303 322 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup253
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2781
Ophiocordyceps australis 1348a (Ghana) OphauG2|5755
Ophiocordyceps australis map64 (Brazil) OphauB2|3449
Ophiocordyceps australis map64 (Brazil) OphauB2|7166
Ophiocordyceps camponoti-floridani Ophcf2|02691 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05917
Ophiocordyceps camponoti-rufipedis Ophun1|1695
Ophiocordyceps camponoti-rufipedis Ophun1|4829
Ophiocordyceps kimflemingae Ophio5|1104
Ophiocordyceps kimflemingae Ophio5|5232
Ophiocordyceps subramaniannii Hirsu2|815
Ophiocordyceps subramaniannii Hirsu2|8476

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02691
MRLAILAVVVGLAAATDDWLWPRASNDSNAIAEMLPLYPVCAQPCIETALANSPCSETRCICMDQGFRGEVRNCV
KASCRIRDAMQSKNTTEHACQRPRRDKTSSFTAMSVSIAAVAYVIVAARLIFKQFFSQRRRLGVDDWLVFAGAVA
GICCTVINVRGLSQHGIGKDVWTLQAETVSSFKLDFYLVALFYIIMTIVAKAAINFFYLSIFPGERTRLVLWVTA
AVIISFGTASLLVSIFQCRPVSFYWKMYHPDQDLNGGSCINIHVAAFANGGINIGLNVWLIVIPLTVIRKLELHW
KKKLGVTIMFLTGVFDTVVSILRLRSIVHFGNSWNPTWDQFDIAWWSVIETNVALICSSLPTMRLILVLVFPHVF
STIRNKTNSTSSSSTVPRKNGSVDKNVPRMTTMSLEIIEAQNVPRDECEDDDEVANNSDEKSSEAKDRRDSLSIG
IAITK*
Coding >Ophcf2|02691
ATGAGGTTGGCAATCCTGGCCGTCGTCGTCGGATTGGCCGCCGCCACGGACGACTGGCTGTGGCCGAGGGCCTCC
AACGACAGCAATGCCATCGCCGAGATGCTGCCTCTGTATCCGGTTTGCGCGCAACCTTGTATCGAGACGGCATTG
GCCAACAGTCCCTGTTCGGAGACGAGGTGTATCTGTATGGATCAGGGGTTTCGAGGCGAGGTGCGGAATTGTGTC
AAGGCCTCTTGCAGGATTCGCGATGCGATGCAGTCCAAGAACACGACCGAACATGCCTGCCAACGCCCCCGTCGC
GACAAAACGTCGTCCTTTACAGCAATGAGCGTCTCCATCGCGGCCGTCGCCTACGTCATCGTTGCCGCCCGTCTC
ATCTTCAAGCAATTCTTCAGTCAGAGGCGACGACTCGGTGTCGACGACTGGCTCGTCTTCGCCGGAGCCGTGGCG
GGAATCTGCTGCACCGTCATCAACGTCCGGGGCCTGAGTCAACATGGAATCGGAAAGGACGTCTGGACGCTGCAG
GCTGAGACGGTGTCCAGCTTCAAGCTGGATTTCTATCTGGTAGCCTTGTTCTACATCATCATGACCATTGTTGCC
AAGGCTGCCATCAACTTCTTTTACCTCTCCATCTTTCCCGGGGAGCGGACGAGGCTGGTTCTCTGGGTTACGGCC
GCCGTCATCATCAGCTTTGGCACGGCTTCTCTTCTCGTCAGCATCTTTCAGTGTCGGCCCGTCTCCTTTTACTGG
AAGATGTATCACCCTGACCAAGATCTCAATGGCGGATCATGCATCAACATCCACGTCGCCGCCTTTGCCAACGGC
GGCATCAACATCGGGCTCAACGTCTGGCTCATCGTCATCCCGCTGACCGTCATCCGCAAGCTAGAGCTCCACTGG
AAGAAGAAGCTGGGCGTGACCATCATGTTCCTAACAGGCGTCTTCGACACCGTCGTCTCCATACTGCGACTGCGA
TCCATCGTCCACTTCGGCAACTCGTGGAATCCGACGTGGGATCAGTTCGATATCGCCTGGTGGTCCGTCATCGAG
ACCAACGTCGCCCTCATCTGCTCCAGTCTTCCGACCATGCGTCTCATCCTCGTCTTGGTCTTCCCGCATGTGTTT
AGCACGATTCGCAACAAGACGAACTCGACGTCTTCGTCTTCTACCGTTCCTCGAAAGAACGGTTCCGTCGATAAG
AATGTTCCTCGCATGACGACGATGAGTCTTGAAATCATTGAAGCTCAGAACGTACCGCGAGACGAATGTGAAGAC
GACGACGAAGTTGCCAACAACAGCGATGAGAAATCAAGCGAAGCCAAGGATCGAAGAGACTCGTTATCCATCGGA
ATCGCCATCACGAAATAA
Transcript >Ophcf2|02691
ATGAGGTTGGCAATCCTGGCCGTCGTCGTCGGATTGGCCGCCGCCACGGACGACTGGCTGTGGCCGAGGGCCTCC
AACGACAGCAATGCCATCGCCGAGATGCTGCCTCTGTATCCGGTTTGCGCGCAACCTTGTATCGAGACGGCATTG
GCCAACAGTCCCTGTTCGGAGACGAGGTGTATCTGTATGGATCAGGGGTTTCGAGGCGAGGTGCGGAATTGTGTC
AAGGCCTCTTGCAGGATTCGCGATGCGATGCAGTCCAAGAACACGACCGAACATGCCTGCCAACGCCCCCGTCGC
GACAAAACGTCGTCCTTTACAGCAATGAGCGTCTCCATCGCGGCCGTCGCCTACGTCATCGTTGCCGCCCGTCTC
ATCTTCAAGCAATTCTTCAGTCAGAGGCGACGACTCGGTGTCGACGACTGGCTCGTCTTCGCCGGAGCCGTGGCG
GGAATCTGCTGCACCGTCATCAACGTCCGGGGCCTGAGTCAACATGGAATCGGAAAGGACGTCTGGACGCTGCAG
GCTGAGACGGTGTCCAGCTTCAAGCTGGATTTCTATCTGGTAGCCTTGTTCTACATCATCATGACCATTGTTGCC
AAGGCTGCCATCAACTTCTTTTACCTCTCCATCTTTCCCGGGGAGCGGACGAGGCTGGTTCTCTGGGTTACGGCC
GCCGTCATCATCAGCTTTGGCACGGCTTCTCTTCTCGTCAGCATCTTTCAGTGTCGGCCCGTCTCCTTTTACTGG
AAGATGTATCACCCTGACCAAGATCTCAATGGCGGATCATGCATCAACATCCACGTCGCCGCCTTTGCCAACGGC
GGCATCAACATCGGGCTCAACGTCTGGCTCATCGTCATCCCGCTGACCGTCATCCGCAAGCTAGAGCTCCACTGG
AAGAAGAAGCTGGGCGTGACCATCATGTTCCTAACAGGCGTCTTCGACACCGTCGTCTCCATACTGCGACTGCGA
TCCATCGTCCACTTCGGCAACTCGTGGAATCCGACGTGGGATCAGTTCGATATCGCCTGGTGGTCCGTCATCGAG
ACCAACGTCGCCCTCATCTGCTCCAGTCTTCCGACCATGCGTCTCATCCTCGTCTTGGTCTTCCCGCATGTGTTT
AGCACGATTCGCAACAAGACGAACTCGACGTCTTCGTCTTCTACCGTTCCTCGAAAGAACGGTTCCGTCGATAAG
AATGTTCCTCGCATGACGACGATGAGTCTTGAAATCATTGAAGCTCAGAACGTACCGCGAGACGAATGTGAAGAC
GACGACGAAGTTGCCAACAACAGCGATGAGAAATCAAGCGAAGCCAAGGATCGAAGAGACTCGTTATCCATCGGA
ATCGCCATCACGAAATAA
Gene >Ophcf2|02691
ATGAGGTTGGCAATCCTGGCCGTCGTCGTCGGATTGGCCGCCGCCACGGACGACTGGCTGTGGCCGAGGGCCTCC
AACGACAGCAATGCCATCGCCGAGATGCTGCCTCTGTATCCGGTTTGCGCGGTAAGACGACGAGGCCTGGCCGTG
CTTCCAAGAGGGGAGTTTTACTGACCGACGAGGTTGTTGCCAGCAACCTTGTATCGAGACGGCATTGGCCAACAG
TCCCTGTTCGGAGACGAGGTGTATCTGTATGGATCAGGGGTTTCGAGGCGAGGTGCGGAATTGTGTCAAGGCCTC
TTGCAGGATTCGCGATGCGATGCGTGAGTTTGGACGGGTTTCCCCGGCATCTACGCCTTGAACCTTGACTGAAGA
TGGAGATGCAGAGTCCAAGAACACGACCGAACATGCCTGCCAACGCCCCCGTCGCGACAAAACGTCGTCCTTTAC
AGCAATGAGCGTCTCCATCGCGGCCGTCGCCTACGTCATCGTTGCCGCCCGTCTCATCTTCAAGCAATTCTTCAG
TCAGAGGCGACGACTCGGTGTCGACGACTGGCTCGTCTTCGCCGGAGCCGTGGCGGGAATCTGCTGCACCGTCAT
CAACGTCCGGGGCCTGAGTCAACATGGAATCGGAAAGGACGTCTGGACGCTGCAGGCTGAGACGGTGTCCAGCTT
CAAGCTGGATTTCTATCTGGTAGCCTTGTTCTACATCATCATGACCATTGTTGCCAAGGCTGCCATCAACTTCTT
TTACCTCTCCATCTTTCCCGGGGAGCGGACGAGGCTGGTTCTCTGGGTTACGGCCGCCGTCATCATCAGCTTTGG
CACGGCTTCTCTTCTCGTCAGCATCTTTCAGTGTCGGCCCGTCTCCTTTTACTGGAAGATGTATCACCCTGACCA
AGATCTCAATGGCGGATCATGCATCAACATCCACGTCGCCGCCTTTGCCAACGGCGGCATCAACATCGGGCTCAA
CGTCTGGCTCATCGTCATCCCGCTGACCGTCATCCGCAAGCTAGAGCTCCACTGGAAGAAGAAGCTGGGCGTGAC
CATCATGTTCCTAACAGGCGTCTTCGACACCGTCGTCTCCATACTGCGACTGCGATCCATCGTCCACTTCGGCAA
CTCGTGGAATCCGACGTGGGATCAGTTCGATATCGCCTGGTGGTCCGTCATCGAGACCAACGTCGCCCTCATCTG
CTCCAGTCTTCCGACCATGCGTCTCATCCTCGTCTTGGTCTTCCCGCATGTGTTTAGCACGATTCGCAACAAGAC
GAACTCGACGTCTTCGTCTTCTACCGTTCCTCGAAAGAACGGTTCCGTCGATAAGAATGTTCCTCGCATGACGAC
GATGAGTCTTGAAATCATTGAAGCTCAGAACGTACCGCGAGACGAATGTGAAGACGACGACGAAGTTGCCAACAA
CAGCGATGAGAAATCAAGCGAAGCCAAGGATCGAAGAGACTCGTTATCCATCGGAATCGCCATCACGAAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail