Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02685
Gene name
Locationscaffold_02:4426608..4428852
Strand-
Gene length (bp)2244
Transcript length (bp)2118
Coding sequence length (bp)2118
Protein length (aa) 706

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02383 Syja_N SacI homology domain 9.0E-86 66 407

GO

GO Term Description Terminal node
GO:0016791 phosphatase activity Yes
GO:0042578 phosphoric ester hydrolase activity No
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 591 613 22
2 626 648 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 51.29 29.48 73.10
Alive In ants, during behavior modification 39.00 21.95 56.06
Dead In ants, recently dead 35.34 20.01 50.66

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.154330 no
Alive Dead 0.603218 no
Dead Fungus 0.048237 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02685
MAPLAAAKLPYRDVNVRVTGDAYVFASPSSPDAPALVIDRPTGDLHLADAAQHATKRTIRVSSVAGILGLIQLRL
DKYVIVITKARPVGRLKGHLVYKLVAAEMLPMRERQIHDRDEDTFVSLIKTFLLRGPMYFSYSVDLTSSFQRQSQ
SDNAAPLWTRADDRFFFNKYLQSDLIDFRRRGSRSQPGSQPGVDAYILPCIFGMLEIRPTKFNKTPLTLVLISRR
SRYRGGTRYFTRGVDEDGHVANYNETEQVVVLNDSSSGLGGFGGSSEMQSGRVDAEMQVMSYVQTRGSVPTYWAE
INSLRYVPKLQVRSTESALAAAQKHFDEQIRLYGDNYLINLVNQKGRECRVKESYEHMVQTLVTGPQEGHESDRL
SEDKFTTIQAGARRQMFDRLHYVYFDYHNETKGLQMHRAYMLIEKLSEALAAQAYFRGTDTPAKVDGRVEVRALQ
TSVMRVNCMDCLDRTNVVQSMFARHMLDRILQEAGLMARGASFRDVDPAFELLFRNLWADNADVVSCSYAGTGAM
KTDVTRTGHRTRVGALQDARIGVTRYYLNNFRDGPRQDAYDLFLGVYQPGISDAGTKAVFADGRPLLLQSIPYLL
AFSLFIVLVGLFTRRDSDASPTTMRLFILFWSAVAAWCFYFIWSHGMLYVNWPRLIPRPYAIDGYGEQYSQARKD
MVIGPFVSRHQRGLSAARYLNAEEGKKRIE*
Coding >Ophcf2|02685
ATGGCGCCCCTCGCGGCCGCCAAGCTTCCCTATCGGGACGTCAACGTCCGTGTCACAGGCGACGCCTACGTCTTC
GCCTCGCCTTCGTCGCCCGATGCACCCGCCCTCGTCATCGACCGTCCGACGGGTGACTTGCATCTCGCAGATGCT
GCTCAACACGCTACAAAGCGCACAATCAGGGTGTCGAGCGTCGCCGGCATTTTGGGCCTCATACAGCTGAGACTC
GACAAGTATGTCATCGTCATTACAAAGGCCCGTCCCGTTGGTCGGCTCAAGGGCCACCTGGTCTACAAGCTCGTG
GCGGCCGAGATGCTCCCCATGCGCGAGCGCCAGATCCACGACCGCGACGAGGACACCTTTGTCAGCCTCATAAAG
ACGTTTTTGCTCCGCGGGCCCATGTACTTTTCCTACTCAGTCGACCTCACCAGCTCGTTCCAGCGCCAGTCTCAG
TCGGACAATGCGGCGCCGCTTTGGACCAGAGCTGACGACCGCTTCTTCTTCAACAAGTACCTGCAGTCGGACCTC
ATCGACTTTCGCAGACGCGGCTCCCGGAGTCAGCCTGGCAGCCAGCCGGGCGTCGATGCCTACATTCTGCCCTGC
ATCTTTGGCATGCTAGAGATCCGGCCGACCAAGTTTAACAAGACACCGCTCACGCTCGTCTTGATCTCGCGAAGA
TCCCGCTACCGTGGCGGAACGCGCTACTTCACGCGCGGCGTCGACGAGGATGGCCACGTAGCCAATTACAACGAG
ACGGAGCAGGTGGTGGTGCTCAACGATAGCAGCAGTGGACTGGGAGGTTTCGGCGGTAGCTCCGAGATGCAGAGC
GGTCGCGTCGACGCAGAGATGCAGGTCATGTCGTACGTCCAGACGCGCGGGAGCGTGCCGACGTACTGGGCCGAG
ATCAATAGCCTGCGATACGTGCCGAAGCTACAGGTACGAAGCACCGAGTCGGCGCTGGCGGCGGCGCAGAAACAC
TTTGACGAGCAGATCCGGCTCTACGGCGACAACTACCTCATCAACCTCGTCAACCAAAAGGGCCGCGAGTGCCGG
GTCAAAGAGTCGTACGAACACATGGTGCAGACGCTGGTGACTGGCCCGCAGGAGGGTCACGAGTCGGACAGACTC
AGCGAGGACAAGTTCACGACGATCCAGGCAGGGGCCAGACGACAGATGTTTGACCGTCTGCACTACGTCTACTTC
GACTATCACAACGAGACAAAGGGTCTGCAAATGCACAGGGCTTATATGCTCATCGAAAAGCTCAGCGAAGCCCTC
GCCGCCCAGGCCTACTTCCGCGGCACCGACACACCAGCCAAGGTAGACGGCCGAGTCGAGGTACGGGCACTGCAG
ACGAGCGTGATGCGCGTCAACTGCATGGACTGCCTGGACCGAACCAACGTGGTGCAGAGCATGTTTGCCCGCCAC
ATGCTCGACCGAATCCTCCAAGAAGCCGGCCTGATGGCCCGAGGAGCCAGCTTCCGCGACGTCGACCCAGCCTTT
GAGCTCCTCTTCCGCAACCTCTGGGCCGACAACGCCGACGTCGTCTCTTGCTCGTACGCAGGCACCGGCGCCATG
AAGACGGACGTGACGCGCACCGGACACCGCACCAGAGTCGGAGCCCTACAAGACGCTCGCATCGGCGTGACGCGC
TACTACCTCAACAACTTCCGCGACGGTCCTCGTCAGGACGCCTACGATCTCTTCCTCGGCGTCTACCAGCCCGGG
ATCTCCGACGCCGGCACCAAAGCCGTCTTCGCCGACGGCCGTCCCCTCCTCCTACAGTCGATCCCCTACCTACTG
GCCTTTAGCCTCTTCATCGTCCTCGTCGGCCTCTTCACCCGCCGCGACTCCGACGCGTCGCCCACGACGATGCGC
CTCTTCATCTTATTCTGGTCCGCCGTCGCCGCCTGGTGCTTTTACTTCATCTGGTCGCACGGCATGCTCTACGTA
AACTGGCCACGCCTCATCCCCCGCCCCTACGCCATCGACGGCTACGGCGAGCAATACTCACAGGCACGCAAGGAC
ATGGTCATCGGTCCCTTTGTCTCGCGCCACCAGCGAGGCCTCAGCGCGGCGAGATACCTCAATGCCGAGGAGGGA
AAGAAGAGGATCGAATGA
Transcript >Ophcf2|02685
ATGGCGCCCCTCGCGGCCGCCAAGCTTCCCTATCGGGACGTCAACGTCCGTGTCACAGGCGACGCCTACGTCTTC
GCCTCGCCTTCGTCGCCCGATGCACCCGCCCTCGTCATCGACCGTCCGACGGGTGACTTGCATCTCGCAGATGCT
GCTCAACACGCTACAAAGCGCACAATCAGGGTGTCGAGCGTCGCCGGCATTTTGGGCCTCATACAGCTGAGACTC
GACAAGTATGTCATCGTCATTACAAAGGCCCGTCCCGTTGGTCGGCTCAAGGGCCACCTGGTCTACAAGCTCGTG
GCGGCCGAGATGCTCCCCATGCGCGAGCGCCAGATCCACGACCGCGACGAGGACACCTTTGTCAGCCTCATAAAG
ACGTTTTTGCTCCGCGGGCCCATGTACTTTTCCTACTCAGTCGACCTCACCAGCTCGTTCCAGCGCCAGTCTCAG
TCGGACAATGCGGCGCCGCTTTGGACCAGAGCTGACGACCGCTTCTTCTTCAACAAGTACCTGCAGTCGGACCTC
ATCGACTTTCGCAGACGCGGCTCCCGGAGTCAGCCTGGCAGCCAGCCGGGCGTCGATGCCTACATTCTGCCCTGC
ATCTTTGGCATGCTAGAGATCCGGCCGACCAAGTTTAACAAGACACCGCTCACGCTCGTCTTGATCTCGCGAAGA
TCCCGCTACCGTGGCGGAACGCGCTACTTCACGCGCGGCGTCGACGAGGATGGCCACGTAGCCAATTACAACGAG
ACGGAGCAGGTGGTGGTGCTCAACGATAGCAGCAGTGGACTGGGAGGTTTCGGCGGTAGCTCCGAGATGCAGAGC
GGTCGCGTCGACGCAGAGATGCAGGTCATGTCGTACGTCCAGACGCGCGGGAGCGTGCCGACGTACTGGGCCGAG
ATCAATAGCCTGCGATACGTGCCGAAGCTACAGGTACGAAGCACCGAGTCGGCGCTGGCGGCGGCGCAGAAACAC
TTTGACGAGCAGATCCGGCTCTACGGCGACAACTACCTCATCAACCTCGTCAACCAAAAGGGCCGCGAGTGCCGG
GTCAAAGAGTCGTACGAACACATGGTGCAGACGCTGGTGACTGGCCCGCAGGAGGGTCACGAGTCGGACAGACTC
AGCGAGGACAAGTTCACGACGATCCAGGCAGGGGCCAGACGACAGATGTTTGACCGTCTGCACTACGTCTACTTC
GACTATCACAACGAGACAAAGGGTCTGCAAATGCACAGGGCTTATATGCTCATCGAAAAGCTCAGCGAAGCCCTC
GCCGCCCAGGCCTACTTCCGCGGCACCGACACACCAGCCAAGGTAGACGGCCGAGTCGAGGTACGGGCACTGCAG
ACGAGCGTGATGCGCGTCAACTGCATGGACTGCCTGGACCGAACCAACGTGGTGCAGAGCATGTTTGCCCGCCAC
ATGCTCGACCGAATCCTCCAAGAAGCCGGCCTGATGGCCCGAGGAGCCAGCTTCCGCGACGTCGACCCAGCCTTT
GAGCTCCTCTTCCGCAACCTCTGGGCCGACAACGCCGACGTCGTCTCTTGCTCGTACGCAGGCACCGGCGCCATG
AAGACGGACGTGACGCGCACCGGACACCGCACCAGAGTCGGAGCCCTACAAGACGCTCGCATCGGCGTGACGCGC
TACTACCTCAACAACTTCCGCGACGGTCCTCGTCAGGACGCCTACGATCTCTTCCTCGGCGTCTACCAGCCCGGG
ATCTCCGACGCCGGCACCAAAGCCGTCTTCGCCGACGGCCGTCCCCTCCTCCTACAGTCGATCCCCTACCTACTG
GCCTTTAGCCTCTTCATCGTCCTCGTCGGCCTCTTCACCCGCCGCGACTCCGACGCGTCGCCCACGACGATGCGC
CTCTTCATCTTATTCTGGTCCGCCGTCGCCGCCTGGTGCTTTTACTTCATCTGGTCGCACGGCATGCTCTACGTA
AACTGGCCACGCCTCATCCCCCGCCCCTACGCCATCGACGGCTACGGCGAGCAATACTCACAGGCACGCAAGGAC
ATGGTCATCGGTCCCTTTGTCTCGCGCCACCAGCGAGGCCTCAGCGCGGCGAGATACCTCAATGCCGAGGAGGGA
AAGAAGAGGATCGAATGA
Gene >Ophcf2|02685
ATGGCGCCCCTCGCGGCCGCCAAGCTTCCCTATCGGGACGTCAACGTCCGTGTCACAGGCGACGCCTACGTCTTC
GCCTCGCCTTCGTCGCCCGATGCACCCGCCCTCGTCATCGACCGTCCGACGGGTGACTTGCATCTCGCAGATGCT
GCTCAACACGCTACAAAGCGCACAATCAGGGTGTCGAGCGTCGCCGGCATTTTGGGCCTCATACAGCTGAGACTC
GGTCCGTGACGTGCTCCCCGCTTCGACGCCGCTTGCTGACCAGCTCGAGCTCAGACAAGTATGTCATCGTCATTA
CAAAGGCCCGTCCCGTTGGTCGGCTCAAGGGCCACCTGGTCTACAAGCTCGTGGCGGCCGAGATGCTCCCCATGC
GCGAGCGCCAGATCCACGACCGCGACGAGGACACCTTTGTCAGCCTCATAAAGACGTTTTTGCTCCGCGGGCCCA
TGTACTTTTCCTACTCAGTCGACCTCACCAGCTCGTTCCAGCGCCAGTCTCAGTCGGACAATGCGGCGCCGCTTT
GGACCAGAGCTGACGACCGCTTCTTCTTCAACAAGTACCTGCAGTCGGACCTCATCGACTTTCGCAGACGCGGCT
CCCGGAGTCAGCCTGGCAGCCAGCCGGGCGTCGATGCCTACATTCTGCCCTGCATCTTTGGCATGCTAGAGATCC
GGCCGACCAAGTTTAACAAGACACCGCTCACGCTCGTCTTGATCTCGCGAAGATCCCGCTACCGTGGCGGAACGC
GCTACTTCACGCGCGGCGTCGACGAGGATGGCCACGTAGCCAATTACAACGAGACGGAGCAGGTGGTGGTGCTCA
ACGATAGCAGCAGTGGACTGGGAGGTTTCGGCGGTAGCTCCGAGATGCAGAGCGGTCGCGTCGACGCAGAGATGC
AGGTCATGTCGTACGTCCAGACGCGCGGGAGCGTGCCGACGTACTGGGCCGAGATCAATAGCCTGCGATACGTGC
CGAAGCTACAGGTACGAAGCACCGAGTCGGCGCTGGCGGCGGCGCAGAAACACTTTGACGAGCAGATCCGGCTCT
ACGGCGACAACTACCTCATCAACCTCGTCAACCAAAAGGGCCGCGAGTGCCGGGTCAAAGAGTCGTACGAACACA
TGGTGCAGACGCTGGTGACTGGCCCGCAGGAGGGTCACGAGTCGGACAGACTCAGCGAGGACAAGTTCACGACGA
TCCAGGCAGGGGCCAGACGACAGATGTTTGACCGTCTGCACTACGTCTACTTCGACTATCACAACGAGACAAAGG
GTCTGCAAATGCACAGGGCTTATATGCTCATCGAAAAGCTCAGCGAAGCCCTCGCCGCCCAGGCCTACTTCCGCG
GCACCGACACACCAGCCAAGGTAGACGGCCGAGTCGAGGTACGGGCACTGCAGACGAGCGTGATGCGCGTCAACT
GCATGGACTGCCTGGACCGAACCAACGTGGTGCAGAGCATGTTTGCCCGCCACATGCTCGACCGAATCCTCCAAG
AAGCCGGCCTGATGGCCCGAGGAGCCAGCTTCCGCGACGTCGACCCAGCCTTTGAGCTCCTCTTCCGCAACCTCT
GGGCCGACAACGCCGACGTCGTCTCTTGCTCGTACGCAGGCACCGGCGCCATGAAGACGGACGTGACGCGCACCG
GACACCGCACCAGAGTCGGAGCCCTACAAGACGCTCGCATCGGCGTGACGCGCTACTACCTCAACAACTTCCGCG
ACGGTCCTCGTCAGGACGCCTACGATCTCTTCCTCGGCGTCTACCAGCCCGGGATCTCCGACGCCGGCACCAAAG
CCGTCTTCGCCGACGGCCGTCCCCTCCTCCTACAGTCGATCCCCTACCTACTGGCCTTTAGCCTCTTCATCGTCC
TCGTCGGCCTCTTCACCCGCCGCGACTCCGACGCGTCGCCCACGACGATGCGCCTCTTCATCTTATTCTGGTCCG
CCGTCGCCGCCTGGTGCTTTTACTTCATCTGGTCGCACGGCATGCTCTACGTACGTCCCCCCTCCCCCCTTATCC
ACACCCTCATCATCCACCCCGGTCTAACGCGATACTCCTCGCCCCCAGGTAAACTGGCCACGCCTCATCCCCCGC
CCCTACGCCATCGACGGCTACGGCGAGCAATACTCACAGGCACGCAAGGACATGGTCATCGGTCCCTTTGTCTCG
CGCCACCAGCGAGGCCTCAGCGCGGCGAGATACCTCAATGCCGAGGAGGGAAAGAAGAGGATCGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail