Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02685
Gene name
Locationscaffold_02:4426608..4428852
Strand-
Gene length (bp)2244
Transcript length (bp)2118
Coding sequence length (bp)2118
Protein length (aa) 706

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02383 Syja_N SacI homology domain 9.0E-86 66 407

GO

GO Term Description Terminal node
GO:0016791 phosphatase activity Yes
GO:0042578 phosphoric ester hydrolase activity No
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 591 613 22
2 626 648 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02685
MAPLAAAKLPYRDVNVRVTGDAYVFASPSSPDAPALVIDRPTGDLHLADAAQHATKRTIRVSSVAGILGLIQLRL
DKYVIVITKARPVGRLKGHLVYKLVAAEMLPMRERQIHDRDEDTFVSLIKTFLLRGPMYFSYSVDLTSSFQRQSQ
SDNAAPLWTRADDRFFFNKYLQSDLIDFRRRGSRSQPGSQPGVDAYILPCIFGMLEIRPTKFNKTPLTLVLISRR
SRYRGGTRYFTRGVDEDGHVANYNETEQVVVLNDSSSGLGGFGGSSEMQSGRVDAEMQVMSYVQTRGSVPTYWAE
INSLRYVPKLQVRSTESALAAAQKHFDEQIRLYGDNYLINLVNQKGRECRVKESYEHMVQTLVTGPQEGHESDRL
SEDKFTTIQAGARRQMFDRLHYVYFDYHNETKGLQMHRAYMLIEKLSEALAAQAYFRGTDTPAKVDGRVEVRALQ
TSVMRVNCMDCLDRTNVVQSMFARHMLDRILQEAGLMARGASFRDVDPAFELLFRNLWADNADVVSCSYAGTGAM
KTDVTRTGHRTRVGALQDARIGVTRYYLNNFRDGPRQDAYDLFLGVYQPGISDAGTKAVFADGRPLLLQSIPYLL
AFSLFIVLVGLFTRRDSDASPTTMRLFILFWSAVAAWCFYFIWSHGMLYVNWPRLIPRPYAIDGYGEQYSQARKD
MVIGPFVSRHQRGLSAARYLNAEEGKKRIE*
Coding >Ophcf2|02685
ATGGCGCCCCTCGCGGCCGCCAAGCTTCCCTATCGGGACGTCAACGTCCGTGTCACAGGCGACGCCTACGTCTTC
GCCTCGCCTTCGTCGCCCGATGCACCCGCCCTCGTCATCGACCGTCCGACGGGTGACTTGCATCTCGCAGATGCT
GCTCAACACGCTACAAAGCGCACAATCAGGGTGTCGAGCGTCGCCGGCATTTTGGGCCTCATACAGCTGAGACTC
GACAAGTATGTCATCGTCATTACAAAGGCCCGTCCCGTTGGTCGGCTCAAGGGCCACCTGGTCTACAAGCTCGTG
GCGGCCGAGATGCTCCCCATGCGCGAGCGCCAGATCCACGACCGCGACGAGGACACCTTTGTCAGCCTCATAAAG
ACGTTTTTGCTCCGCGGGCCCATGTACTTTTCCTACTCAGTCGACCTCACCAGCTCGTTCCAGCGCCAGTCTCAG
TCGGACAATGCGGCGCCGCTTTGGACCAGAGCTGACGACCGCTTCTTCTTCAACAAGTACCTGCAGTCGGACCTC
ATCGACTTTCGCAGACGCGGCTCCCGGAGTCAGCCTGGCAGCCAGCCGGGCGTCGATGCCTACATTCTGCCCTGC
ATCTTTGGCATGCTAGAGATCCGGCCGACCAAGTTTAACAAGACACCGCTCACGCTCGTCTTGATCTCGCGAAGA
TCCCGCTACCGTGGCGGAACGCGCTACTTCACGCGCGGCGTCGACGAGGATGGCCACGTAGCCAATTACAACGAG
ACGGAGCAGGTGGTGGTGCTCAACGATAGCAGCAGTGGACTGGGAGGTTTCGGCGGTAGCTCCGAGATGCAGAGC
GGTCGCGTCGACGCAGAGATGCAGGTCATGTCGTACGTCCAGACGCGCGGGAGCGTGCCGACGTACTGGGCCGAG
ATCAATAGCCTGCGATACGTGCCGAAGCTACAGGTACGAAGCACCGAGTCGGCGCTGGCGGCGGCGCAGAAACAC
TTTGACGAGCAGATCCGGCTCTACGGCGACAACTACCTCATCAACCTCGTCAACCAAAAGGGCCGCGAGTGCCGG
GTCAAAGAGTCGTACGAACACATGGTGCAGACGCTGGTGACTGGCCCGCAGGAGGGTCACGAGTCGGACAGACTC
AGCGAGGACAAGTTCACGACGATCCAGGCAGGGGCCAGACGACAGATGTTTGACCGTCTGCACTACGTCTACTTC
GACTATCACAACGAGACAAAGGGTCTGCAAATGCACAGGGCTTATATGCTCATCGAAAAGCTCAGCGAAGCCCTC
GCCGCCCAGGCCTACTTCCGCGGCACCGACACACCAGCCAAGGTAGACGGCCGAGTCGAGGTACGGGCACTGCAG
ACGAGCGTGATGCGCGTCAACTGCATGGACTGCCTGGACCGAACCAACGTGGTGCAGAGCATGTTTGCCCGCCAC
ATGCTCGACCGAATCCTCCAAGAAGCCGGCCTGATGGCCCGAGGAGCCAGCTTCCGCGACGTCGACCCAGCCTTT
GAGCTCCTCTTCCGCAACCTCTGGGCCGACAACGCCGACGTCGTCTCTTGCTCGTACGCAGGCACCGGCGCCATG
AAGACGGACGTGACGCGCACCGGACACCGCACCAGAGTCGGAGCCCTACAAGACGCTCGCATCGGCGTGACGCGC
TACTACCTCAACAACTTCCGCGACGGTCCTCGTCAGGACGCCTACGATCTCTTCCTCGGCGTCTACCAGCCCGGG
ATCTCCGACGCCGGCACCAAAGCCGTCTTCGCCGACGGCCGTCCCCTCCTCCTACAGTCGATCCCCTACCTACTG
GCCTTTAGCCTCTTCATCGTCCTCGTCGGCCTCTTCACCCGCCGCGACTCCGACGCGTCGCCCACGACGATGCGC
CTCTTCATCTTATTCTGGTCCGCCGTCGCCGCCTGGTGCTTTTACTTCATCTGGTCGCACGGCATGCTCTACGTA
AACTGGCCACGCCTCATCCCCCGCCCCTACGCCATCGACGGCTACGGCGAGCAATACTCACAGGCACGCAAGGAC
ATGGTCATCGGTCCCTTTGTCTCGCGCCACCAGCGAGGCCTCAGCGCGGCGAGATACCTCAATGCCGAGGAGGGA
AAGAAGAGGATCGAATGA
Transcript >Ophcf2|02685
ATGGCGCCCCTCGCGGCCGCCAAGCTTCCCTATCGGGACGTCAACGTCCGTGTCACAGGCGACGCCTACGTCTTC
GCCTCGCCTTCGTCGCCCGATGCACCCGCCCTCGTCATCGACCGTCCGACGGGTGACTTGCATCTCGCAGATGCT
GCTCAACACGCTACAAAGCGCACAATCAGGGTGTCGAGCGTCGCCGGCATTTTGGGCCTCATACAGCTGAGACTC
GACAAGTATGTCATCGTCATTACAAAGGCCCGTCCCGTTGGTCGGCTCAAGGGCCACCTGGTCTACAAGCTCGTG
GCGGCCGAGATGCTCCCCATGCGCGAGCGCCAGATCCACGACCGCGACGAGGACACCTTTGTCAGCCTCATAAAG
ACGTTTTTGCTCCGCGGGCCCATGTACTTTTCCTACTCAGTCGACCTCACCAGCTCGTTCCAGCGCCAGTCTCAG
TCGGACAATGCGGCGCCGCTTTGGACCAGAGCTGACGACCGCTTCTTCTTCAACAAGTACCTGCAGTCGGACCTC
ATCGACTTTCGCAGACGCGGCTCCCGGAGTCAGCCTGGCAGCCAGCCGGGCGTCGATGCCTACATTCTGCCCTGC
ATCTTTGGCATGCTAGAGATCCGGCCGACCAAGTTTAACAAGACACCGCTCACGCTCGTCTTGATCTCGCGAAGA
TCCCGCTACCGTGGCGGAACGCGCTACTTCACGCGCGGCGTCGACGAGGATGGCCACGTAGCCAATTACAACGAG
ACGGAGCAGGTGGTGGTGCTCAACGATAGCAGCAGTGGACTGGGAGGTTTCGGCGGTAGCTCCGAGATGCAGAGC
GGTCGCGTCGACGCAGAGATGCAGGTCATGTCGTACGTCCAGACGCGCGGGAGCGTGCCGACGTACTGGGCCGAG
ATCAATAGCCTGCGATACGTGCCGAAGCTACAGGTACGAAGCACCGAGTCGGCGCTGGCGGCGGCGCAGAAACAC
TTTGACGAGCAGATCCGGCTCTACGGCGACAACTACCTCATCAACCTCGTCAACCAAAAGGGCCGCGAGTGCCGG
GTCAAAGAGTCGTACGAACACATGGTGCAGACGCTGGTGACTGGCCCGCAGGAGGGTCACGAGTCGGACAGACTC
AGCGAGGACAAGTTCACGACGATCCAGGCAGGGGCCAGACGACAGATGTTTGACCGTCTGCACTACGTCTACTTC
GACTATCACAACGAGACAAAGGGTCTGCAAATGCACAGGGCTTATATGCTCATCGAAAAGCTCAGCGAAGCCCTC
GCCGCCCAGGCCTACTTCCGCGGCACCGACACACCAGCCAAGGTAGACGGCCGAGTCGAGGTACGGGCACTGCAG
ACGAGCGTGATGCGCGTCAACTGCATGGACTGCCTGGACCGAACCAACGTGGTGCAGAGCATGTTTGCCCGCCAC
ATGCTCGACCGAATCCTCCAAGAAGCCGGCCTGATGGCCCGAGGAGCCAGCTTCCGCGACGTCGACCCAGCCTTT
GAGCTCCTCTTCCGCAACCTCTGGGCCGACAACGCCGACGTCGTCTCTTGCTCGTACGCAGGCACCGGCGCCATG
AAGACGGACGTGACGCGCACCGGACACCGCACCAGAGTCGGAGCCCTACAAGACGCTCGCATCGGCGTGACGCGC
TACTACCTCAACAACTTCCGCGACGGTCCTCGTCAGGACGCCTACGATCTCTTCCTCGGCGTCTACCAGCCCGGG
ATCTCCGACGCCGGCACCAAAGCCGTCTTCGCCGACGGCCGTCCCCTCCTCCTACAGTCGATCCCCTACCTACTG
GCCTTTAGCCTCTTCATCGTCCTCGTCGGCCTCTTCACCCGCCGCGACTCCGACGCGTCGCCCACGACGATGCGC
CTCTTCATCTTATTCTGGTCCGCCGTCGCCGCCTGGTGCTTTTACTTCATCTGGTCGCACGGCATGCTCTACGTA
AACTGGCCACGCCTCATCCCCCGCCCCTACGCCATCGACGGCTACGGCGAGCAATACTCACAGGCACGCAAGGAC
ATGGTCATCGGTCCCTTTGTCTCGCGCCACCAGCGAGGCCTCAGCGCGGCGAGATACCTCAATGCCGAGGAGGGA
AAGAAGAGGATCGAATGA
Gene >Ophcf2|02685
ATGGCGCCCCTCGCGGCCGCCAAGCTTCCCTATCGGGACGTCAACGTCCGTGTCACAGGCGACGCCTACGTCTTC
GCCTCGCCTTCGTCGCCCGATGCACCCGCCCTCGTCATCGACCGTCCGACGGGTGACTTGCATCTCGCAGATGCT
GCTCAACACGCTACAAAGCGCACAATCAGGGTGTCGAGCGTCGCCGGCATTTTGGGCCTCATACAGCTGAGACTC
GGTCCGTGACGTGCTCCCCGCTTCGACGCCGCTTGCTGACCAGCTCGAGCTCAGACAAGTATGTCATCGTCATTA
CAAAGGCCCGTCCCGTTGGTCGGCTCAAGGGCCACCTGGTCTACAAGCTCGTGGCGGCCGAGATGCTCCCCATGC
GCGAGCGCCAGATCCACGACCGCGACGAGGACACCTTTGTCAGCCTCATAAAGACGTTTTTGCTCCGCGGGCCCA
TGTACTTTTCCTACTCAGTCGACCTCACCAGCTCGTTCCAGCGCCAGTCTCAGTCGGACAATGCGGCGCCGCTTT
GGACCAGAGCTGACGACCGCTTCTTCTTCAACAAGTACCTGCAGTCGGACCTCATCGACTTTCGCAGACGCGGCT
CCCGGAGTCAGCCTGGCAGCCAGCCGGGCGTCGATGCCTACATTCTGCCCTGCATCTTTGGCATGCTAGAGATCC
GGCCGACCAAGTTTAACAAGACACCGCTCACGCTCGTCTTGATCTCGCGAAGATCCCGCTACCGTGGCGGAACGC
GCTACTTCACGCGCGGCGTCGACGAGGATGGCCACGTAGCCAATTACAACGAGACGGAGCAGGTGGTGGTGCTCA
ACGATAGCAGCAGTGGACTGGGAGGTTTCGGCGGTAGCTCCGAGATGCAGAGCGGTCGCGTCGACGCAGAGATGC
AGGTCATGTCGTACGTCCAGACGCGCGGGAGCGTGCCGACGTACTGGGCCGAGATCAATAGCCTGCGATACGTGC
CGAAGCTACAGGTACGAAGCACCGAGTCGGCGCTGGCGGCGGCGCAGAAACACTTTGACGAGCAGATCCGGCTCT
ACGGCGACAACTACCTCATCAACCTCGTCAACCAAAAGGGCCGCGAGTGCCGGGTCAAAGAGTCGTACGAACACA
TGGTGCAGACGCTGGTGACTGGCCCGCAGGAGGGTCACGAGTCGGACAGACTCAGCGAGGACAAGTTCACGACGA
TCCAGGCAGGGGCCAGACGACAGATGTTTGACCGTCTGCACTACGTCTACTTCGACTATCACAACGAGACAAAGG
GTCTGCAAATGCACAGGGCTTATATGCTCATCGAAAAGCTCAGCGAAGCCCTCGCCGCCCAGGCCTACTTCCGCG
GCACCGACACACCAGCCAAGGTAGACGGCCGAGTCGAGGTACGGGCACTGCAGACGAGCGTGATGCGCGTCAACT
GCATGGACTGCCTGGACCGAACCAACGTGGTGCAGAGCATGTTTGCCCGCCACATGCTCGACCGAATCCTCCAAG
AAGCCGGCCTGATGGCCCGAGGAGCCAGCTTCCGCGACGTCGACCCAGCCTTTGAGCTCCTCTTCCGCAACCTCT
GGGCCGACAACGCCGACGTCGTCTCTTGCTCGTACGCAGGCACCGGCGCCATGAAGACGGACGTGACGCGCACCG
GACACCGCACCAGAGTCGGAGCCCTACAAGACGCTCGCATCGGCGTGACGCGCTACTACCTCAACAACTTCCGCG
ACGGTCCTCGTCAGGACGCCTACGATCTCTTCCTCGGCGTCTACCAGCCCGGGATCTCCGACGCCGGCACCAAAG
CCGTCTTCGCCGACGGCCGTCCCCTCCTCCTACAGTCGATCCCCTACCTACTGGCCTTTAGCCTCTTCATCGTCC
TCGTCGGCCTCTTCACCCGCCGCGACTCCGACGCGTCGCCCACGACGATGCGCCTCTTCATCTTATTCTGGTCCG
CCGTCGCCGCCTGGTGCTTTTACTTCATCTGGTCGCACGGCATGCTCTACGTACGTCCCCCCTCCCCCCTTATCC
ACACCCTCATCATCCACCCCGGTCTAACGCGATACTCCTCGCCCCCAGGTAAACTGGCCACGCCTCATCCCCCGC
CCCTACGCCATCGACGGCTACGGCGAGCAATACTCACAGGCACGCAAGGACATGGTCATCGGTCCCTTTGTCTCG
CGCCACCAGCGAGGCCTCAGCGCGGCGAGATACCTCAATGCCGAGGAGGGAAAGAAGAGGATCGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail