Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02684
Gene name
Locationscaffold_02:4422731..4426055
Strand+
Gene length (bp)3324
Transcript length (bp)3324
Coding sequence length (bp)3324
Protein length (aa) 1108

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

Domain # Start End Length
1 1065 1087 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 25.51 14.63 36.38
Alive In ants, during behavior modification 29.40 16.85 41.96
Dead In ants, recently dead 34.79 19.69 49.89

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.491827 no
Alive Dead 0.328120 no
Dead Fungus 0.097179 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02684
MSSPATQEGLATVESRYEMGESSARASLPPSDDDGSRTRRARHRSAGGFMLRDPAPVDRHFAARRRYAHDAPHPK
SRATPQTPDPVTDRGLAMSSDPALRDRLLSPRVRSSAESDYDTADVVSKPANDIDTAQIVNMALSLSESRRMASR
RNLIRGTPPRLAPVPDGSSASNLRQHLQQQRWSSHVVSPGVASPRRASGVRFGSSRDSEAGLDGQYRYNFSSSTL
SRAQKAKETLELMAEYRRLLSALPPLKAPNTSPPRTPSPARAAKRKATTIQPQGREYNPLQYIRNRKVRARERMA
ISGEKQGFGDVQDVRQWVDRVRQRSPILTADPEDEEDGPLMPPFPGADSPDSQTSTQAATSSSASSSRAAARSRR
PRVDWFIEPCDMMADAYWLEHDHHKLLIEDRQWRKIYPDTCRPKSSEAMQPVPSSSEAIAESNAPANVTRSTSTK
SRAKQKFQKAFPHRHNGSVHGYPHRRHHRPLELKRPRRHSTGEALSGGKDANRGTHINRTSNAHELMERQMMNMV
ADEAQDLEMTDLVDDEDSVIVPPVAAHRKSVSMIDSERRGIEGSPSRRARVDPSSSSAERPILIPSTIASDVEFA
AVERGTTSGSALSSTSGRHDSPTRNALTKIRNVIQDKNSETGDGADASQDGDRHPRGRKSTSSPDKKWRRPSSPA
KLPALEQPSDSSRPNKRSKSMRNRSDNGGVGLRGLFKGPRLDTVFRGGVFRLNGMLWKKDGPVEPSAAEPDSTDE
SEGERTRGRSRISPPPLPESRPGPRNFLEFMPEFSHAPGAQSRNAGEGRGKETATSSPSRSSRPSSQMEPLKAPL
GGGGGIRSASASPSPFVVDVGNSRVADGSDAWDSESYQGSGLGGEVATESDTRPIGDEAQPASSSSSKRQQQRQQ
QQHWLLADKGRTTGRPSRRDIARIRALLLCSGIKALEMNRRALEAPKTATDVYVGSVPAPAPRDMYLETGRQISA
ASQSSTQKWQASAAHLASQTSPALHQRIGAVRARLVDDLSELARKAANEADETGQELALGQPLKVKHVVDMMDRI
LRRRHRRLRWLRRALWLMVEWLLVGLMWYVWAVVMLLRVSSGVGMAVWRGLRWLFWL*
Coding >Ophcf2|02684
ATGAGTTCCCCAGCGACCCAGGAGGGACTGGCGACGGTCGAGAGTCGCTATGAGATGGGCGAGTCGAGCGCTCGC
GCCAGCCTGCCTCCATCTGACGACGACGGCTCCCGTACGCGACGAGCACGACACCGGTCAGCTGGTGGCTTCATG
CTGCGCGACCCGGCGCCCGTCGACCGTCATTTTGCTGCCCGTCGTCGATATGCCCACGACGCCCCTCACCCCAAG
TCCAGGGCGACGCCCCAGACGCCCGACCCCGTCACCGACCGAGGGCTCGCCATGTCGTCGGACCCGGCACTCCGA
GACCGCCTGCTGTCTCCGCGTGTCCGCTCCTCGGCCGAATCCGACTACGACACCGCCGACGTCGTCTCGAAGCCT
GCAAATGACATTGACACGGCTCAGATCGTCAATATGGCACTCAGCCTGAGCGAATCGCGAAGGATGGCCTCCCGC
CGCAATCTGATCAGAGGCACGCCTCCGCGCCTCGCCCCCGTACCCGACGGCAGCTCCGCGAGCAACCTGCGCCAG
CACCTCCAGCAGCAGCGCTGGTCCTCCCACGTCGTCAGTCCGGGAGTCGCGTCTCCCAGGAGAGCGTCGGGCGTG
AGGTTTGGAAGCTCCCGTGACTCCGAAGCCGGGCTCGACGGCCAGTATCGCTACAACTTCTCGTCGTCGACCTTG
TCGCGGGCGCAGAAGGCCAAGGAGACGCTGGAACTCATGGCCGAATATCGCCGCCTGCTGTCAGCCCTTCCGCCG
CTCAAGGCTCCCAATACCAGTCCGCCGAGAACTCCGTCGCCCGCCAGGGCTGCCAAACGCAAGGCGACGACGATC
CAGCCTCAGGGTCGGGAGTACAACCCTCTGCAGTACATTCGGAACCGCAAAGTGAGGGCACGCGAGCGCATGGCC
ATTAGCGGGGAGAAGCAGGGCTTTGGGGACGTACAGGACGTCCGGCAGTGGGTCGACAGGGTCCGTCAGCGGTCG
CCTATCCTCACCGCCGACCCGGAGGATGAAGAGGACGGGCCCCTGATGCCGCCTTTTCCCGGTGCCGATAGCCCG
GACAGTCAGACGTCGACACAGGCTGCAACTTCATCCTCCGCATCCTCGTCGCGCGCCGCCGCGCGGTCCAGACGG
CCCAGGGTCGACTGGTTCATCGAGCCGTGCGACATGATGGCGGATGCCTACTGGCTGGAACACGACCATCACAAG
CTCCTCATCGAAGACCGGCAGTGGCGCAAGATCTACCCAGACACTTGTCGACCCAAATCGAGCGAGGCGATGCAG
CCAGTCCCTTCATCGTCGGAAGCCATCGCCGAGTCGAATGCTCCCGCCAACGTTACTCGCTCGACGAGCACCAAA
AGCCGGGCAAAGCAAAAGTTTCAAAAGGCATTCCCTCACCGTCACAATGGCTCCGTGCACGGCTACCCCCATCGT
CGTCATCATCGTCCGCTTGAGCTCAAACGGCCTAGGAGACACTCGACCGGGGAGGCGCTGTCTGGCGGGAAGGAC
GCGAATCGCGGGACGCACATCAACCGGACGAGCAACGCACACGAGCTCATGGAGCGGCAGATGATGAACATGGTC
GCGGACGAGGCGCAGGACCTGGAAATGACCGACTTGGTCGACGATGAGGATTCCGTCATCGTTCCCCCGGTTGCG
GCTCATCGGAAATCAGTCTCGATGATAGACTCGGAACGCAGGGGGATCGAGGGTTCACCCTCCCGAAGAGCGCGA
GTCGATCCGTCGTCGTCCTCGGCCGAAAGACCGATATTGATTCCCTCGACGATAGCATCGGACGTCGAGTTCGCC
GCCGTCGAGCGCGGAACGACGTCGGGCTCGGCGCTGTCGTCGACGTCTGGCCGGCACGACTCGCCGACGAGGAAC
GCGCTGACCAAGATCAGGAACGTCATACAGGACAAGAATAGCGAGACGGGGGATGGAGCCGACGCGAGCCAAGAT
GGGGATCGCCACCCACGGGGCCGAAAGTCGACCTCGTCTCCTGACAAGAAGTGGCGGCGCCCTTCCAGCCCTGCC
AAGCTGCCCGCCTTGGAGCAGCCGTCGGACAGTTCGAGACCGAACAAGAGGTCCAAGAGCATGCGGAACCGATCC
GATAACGGCGGCGTCGGTCTGCGTGGCCTGTTCAAGGGACCTAGGCTCGACACCGTCTTCCGAGGCGGCGTCTTC
CGCCTCAATGGCATGTTATGGAAGAAGGACGGGCCGGTCGAGCCGTCTGCCGCCGAGCCGGACTCGACGGATGAG
TCGGAGGGCGAGAGAACACGTGGTCGGTCGAGGATCTCGCCTCCGCCGCTGCCAGAGAGCCGGCCCGGGCCGCGC
AACTTTCTCGAGTTTATGCCCGAGTTCAGCCACGCACCCGGCGCGCAGTCGCGCAACGCCGGAGAGGGCCGCGGC
AAGGAAACGGCTACGAGCTCGCCGAGCCGGTCGAGTCGGCCGTCGTCGCAGATGGAGCCGCTCAAGGCGCCCCTG
GGCGGTGGCGGCGGTATTCGCAGCGCCTCCGCCTCGCCTTCGCCCTTTGTCGTCGACGTCGGAAACTCTCGTGTT
GCCGACGGCTCCGACGCCTGGGACTCGGAGTCGTACCAGGGCAGCGGTTTGGGTGGCGAGGTGGCGACCGAATCA
GACACGCGGCCCATCGGAGACGAGGCGCAGCCGGCGTCGTCATCGTCGTCGAAGCGGCAGCAGCAGCGGCAGCAG
CAGCAGCACTGGCTCTTGGCGGATAAGGGCCGGACGACGGGGCGGCCCTCGAGGCGGGATATCGCTCGGATCCGG
GCCCTACTTCTCTGCTCCGGCATCAAGGCGCTCGAGATGAACCGCCGCGCCCTCGAAGCGCCCAAGACGGCGACG
GATGTCTACGTCGGCAGCGTCCCGGCCCCGGCTCCCCGTGACATGTACCTCGAAACAGGCCGCCAAATCAGCGCA
GCAAGCCAATCTTCAACGCAAAAATGGCAAGCCTCAGCAGCCCACCTCGCCAGCCAAACCAGCCCAGCTCTCCAC
CAACGCATCGGAGCCGTACGCGCCCGCCTGGTAGACGACCTCTCGGAACTAGCCCGCAAGGCCGCCAACGAAGCC
GACGAAACGGGCCAGGAGCTCGCGCTAGGCCAGCCCCTAAAGGTCAAGCACGTCGTCGACATGATGGACCGCATC
CTGCGACGGAGACACAGGCGTCTCCGCTGGCTGAGGCGCGCTCTCTGGCTCATGGTCGAGTGGTTGCTCGTTGGC
CTCATGTGGTACGTCTGGGCGGTTGTTATGCTGTTGAGGGTTTCGTCGGGGGTAGGGATGGCGGTTTGGAGGGGA
TTGAGGTGGTTGTTTTGGCTTTAG
Transcript >Ophcf2|02684
ATGAGTTCCCCAGCGACCCAGGAGGGACTGGCGACGGTCGAGAGTCGCTATGAGATGGGCGAGTCGAGCGCTCGC
GCCAGCCTGCCTCCATCTGACGACGACGGCTCCCGTACGCGACGAGCACGACACCGGTCAGCTGGTGGCTTCATG
CTGCGCGACCCGGCGCCCGTCGACCGTCATTTTGCTGCCCGTCGTCGATATGCCCACGACGCCCCTCACCCCAAG
TCCAGGGCGACGCCCCAGACGCCCGACCCCGTCACCGACCGAGGGCTCGCCATGTCGTCGGACCCGGCACTCCGA
GACCGCCTGCTGTCTCCGCGTGTCCGCTCCTCGGCCGAATCCGACTACGACACCGCCGACGTCGTCTCGAAGCCT
GCAAATGACATTGACACGGCTCAGATCGTCAATATGGCACTCAGCCTGAGCGAATCGCGAAGGATGGCCTCCCGC
CGCAATCTGATCAGAGGCACGCCTCCGCGCCTCGCCCCCGTACCCGACGGCAGCTCCGCGAGCAACCTGCGCCAG
CACCTCCAGCAGCAGCGCTGGTCCTCCCACGTCGTCAGTCCGGGAGTCGCGTCTCCCAGGAGAGCGTCGGGCGTG
AGGTTTGGAAGCTCCCGTGACTCCGAAGCCGGGCTCGACGGCCAGTATCGCTACAACTTCTCGTCGTCGACCTTG
TCGCGGGCGCAGAAGGCCAAGGAGACGCTGGAACTCATGGCCGAATATCGCCGCCTGCTGTCAGCCCTTCCGCCG
CTCAAGGCTCCCAATACCAGTCCGCCGAGAACTCCGTCGCCCGCCAGGGCTGCCAAACGCAAGGCGACGACGATC
CAGCCTCAGGGTCGGGAGTACAACCCTCTGCAGTACATTCGGAACCGCAAAGTGAGGGCACGCGAGCGCATGGCC
ATTAGCGGGGAGAAGCAGGGCTTTGGGGACGTACAGGACGTCCGGCAGTGGGTCGACAGGGTCCGTCAGCGGTCG
CCTATCCTCACCGCCGACCCGGAGGATGAAGAGGACGGGCCCCTGATGCCGCCTTTTCCCGGTGCCGATAGCCCG
GACAGTCAGACGTCGACACAGGCTGCAACTTCATCCTCCGCATCCTCGTCGCGCGCCGCCGCGCGGTCCAGACGG
CCCAGGGTCGACTGGTTCATCGAGCCGTGCGACATGATGGCGGATGCCTACTGGCTGGAACACGACCATCACAAG
CTCCTCATCGAAGACCGGCAGTGGCGCAAGATCTACCCAGACACTTGTCGACCCAAATCGAGCGAGGCGATGCAG
CCAGTCCCTTCATCGTCGGAAGCCATCGCCGAGTCGAATGCTCCCGCCAACGTTACTCGCTCGACGAGCACCAAA
AGCCGGGCAAAGCAAAAGTTTCAAAAGGCATTCCCTCACCGTCACAATGGCTCCGTGCACGGCTACCCCCATCGT
CGTCATCATCGTCCGCTTGAGCTCAAACGGCCTAGGAGACACTCGACCGGGGAGGCGCTGTCTGGCGGGAAGGAC
GCGAATCGCGGGACGCACATCAACCGGACGAGCAACGCACACGAGCTCATGGAGCGGCAGATGATGAACATGGTC
GCGGACGAGGCGCAGGACCTGGAAATGACCGACTTGGTCGACGATGAGGATTCCGTCATCGTTCCCCCGGTTGCG
GCTCATCGGAAATCAGTCTCGATGATAGACTCGGAACGCAGGGGGATCGAGGGTTCACCCTCCCGAAGAGCGCGA
GTCGATCCGTCGTCGTCCTCGGCCGAAAGACCGATATTGATTCCCTCGACGATAGCATCGGACGTCGAGTTCGCC
GCCGTCGAGCGCGGAACGACGTCGGGCTCGGCGCTGTCGTCGACGTCTGGCCGGCACGACTCGCCGACGAGGAAC
GCGCTGACCAAGATCAGGAACGTCATACAGGACAAGAATAGCGAGACGGGGGATGGAGCCGACGCGAGCCAAGAT
GGGGATCGCCACCCACGGGGCCGAAAGTCGACCTCGTCTCCTGACAAGAAGTGGCGGCGCCCTTCCAGCCCTGCC
AAGCTGCCCGCCTTGGAGCAGCCGTCGGACAGTTCGAGACCGAACAAGAGGTCCAAGAGCATGCGGAACCGATCC
GATAACGGCGGCGTCGGTCTGCGTGGCCTGTTCAAGGGACCTAGGCTCGACACCGTCTTCCGAGGCGGCGTCTTC
CGCCTCAATGGCATGTTATGGAAGAAGGACGGGCCGGTCGAGCCGTCTGCCGCCGAGCCGGACTCGACGGATGAG
TCGGAGGGCGAGAGAACACGTGGTCGGTCGAGGATCTCGCCTCCGCCGCTGCCAGAGAGCCGGCCCGGGCCGCGC
AACTTTCTCGAGTTTATGCCCGAGTTCAGCCACGCACCCGGCGCGCAGTCGCGCAACGCCGGAGAGGGCCGCGGC
AAGGAAACGGCTACGAGCTCGCCGAGCCGGTCGAGTCGGCCGTCGTCGCAGATGGAGCCGCTCAAGGCGCCCCTG
GGCGGTGGCGGCGGTATTCGCAGCGCCTCCGCCTCGCCTTCGCCCTTTGTCGTCGACGTCGGAAACTCTCGTGTT
GCCGACGGCTCCGACGCCTGGGACTCGGAGTCGTACCAGGGCAGCGGTTTGGGTGGCGAGGTGGCGACCGAATCA
GACACGCGGCCCATCGGAGACGAGGCGCAGCCGGCGTCGTCATCGTCGTCGAAGCGGCAGCAGCAGCGGCAGCAG
CAGCAGCACTGGCTCTTGGCGGATAAGGGCCGGACGACGGGGCGGCCCTCGAGGCGGGATATCGCTCGGATCCGG
GCCCTACTTCTCTGCTCCGGCATCAAGGCGCTCGAGATGAACCGCCGCGCCCTCGAAGCGCCCAAGACGGCGACG
GATGTCTACGTCGGCAGCGTCCCGGCCCCGGCTCCCCGTGACATGTACCTCGAAACAGGCCGCCAAATCAGCGCA
GCAAGCCAATCTTCAACGCAAAAATGGCAAGCCTCAGCAGCCCACCTCGCCAGCCAAACCAGCCCAGCTCTCCAC
CAACGCATCGGAGCCGTACGCGCCCGCCTGGTAGACGACCTCTCGGAACTAGCCCGCAAGGCCGCCAACGAAGCC
GACGAAACGGGCCAGGAGCTCGCGCTAGGCCAGCCCCTAAAGGTCAAGCACGTCGTCGACATGATGGACCGCATC
CTGCGACGGAGACACAGGCGTCTCCGCTGGCTGAGGCGCGCTCTCTGGCTCATGGTCGAGTGGTTGCTCGTTGGC
CTCATGTGGTACGTCTGGGCGGTTGTTATGCTGTTGAGGGTTTCGTCGGGGGTAGGGATGGCGGTTTGGAGGGGA
TTGAGGTGGTTGTTTTGGCTTTAG
Gene >Ophcf2|02684
ATGAGTTCCCCAGCGACCCAGGAGGGACTGGCGACGGTCGAGAGTCGCTATGAGATGGGCGAGTCGAGCGCTCGC
GCCAGCCTGCCTCCATCTGACGACGACGGCTCCCGTACGCGACGAGCACGACACCGGTCAGCTGGTGGCTTCATG
CTGCGCGACCCGGCGCCCGTCGACCGTCATTTTGCTGCCCGTCGTCGATATGCCCACGACGCCCCTCACCCCAAG
TCCAGGGCGACGCCCCAGACGCCCGACCCCGTCACCGACCGAGGGCTCGCCATGTCGTCGGACCCGGCACTCCGA
GACCGCCTGCTGTCTCCGCGTGTCCGCTCCTCGGCCGAATCCGACTACGACACCGCCGACGTCGTCTCGAAGCCT
GCAAATGACATTGACACGGCTCAGATCGTCAATATGGCACTCAGCCTGAGCGAATCGCGAAGGATGGCCTCCCGC
CGCAATCTGATCAGAGGCACGCCTCCGCGCCTCGCCCCCGTACCCGACGGCAGCTCCGCGAGCAACCTGCGCCAG
CACCTCCAGCAGCAGCGCTGGTCCTCCCACGTCGTCAGTCCGGGAGTCGCGTCTCCCAGGAGAGCGTCGGGCGTG
AGGTTTGGAAGCTCCCGTGACTCCGAAGCCGGGCTCGACGGCCAGTATCGCTACAACTTCTCGTCGTCGACCTTG
TCGCGGGCGCAGAAGGCCAAGGAGACGCTGGAACTCATGGCCGAATATCGCCGCCTGCTGTCAGCCCTTCCGCCG
CTCAAGGCTCCCAATACCAGTCCGCCGAGAACTCCGTCGCCCGCCAGGGCTGCCAAACGCAAGGCGACGACGATC
CAGCCTCAGGGTCGGGAGTACAACCCTCTGCAGTACATTCGGAACCGCAAAGTGAGGGCACGCGAGCGCATGGCC
ATTAGCGGGGAGAAGCAGGGCTTTGGGGACGTACAGGACGTCCGGCAGTGGGTCGACAGGGTCCGTCAGCGGTCG
CCTATCCTCACCGCCGACCCGGAGGATGAAGAGGACGGGCCCCTGATGCCGCCTTTTCCCGGTGCCGATAGCCCG
GACAGTCAGACGTCGACACAGGCTGCAACTTCATCCTCCGCATCCTCGTCGCGCGCCGCCGCGCGGTCCAGACGG
CCCAGGGTCGACTGGTTCATCGAGCCGTGCGACATGATGGCGGATGCCTACTGGCTGGAACACGACCATCACAAG
CTCCTCATCGAAGACCGGCAGTGGCGCAAGATCTACCCAGACACTTGTCGACCCAAATCGAGCGAGGCGATGCAG
CCAGTCCCTTCATCGTCGGAAGCCATCGCCGAGTCGAATGCTCCCGCCAACGTTACTCGCTCGACGAGCACCAAA
AGCCGGGCAAAGCAAAAGTTTCAAAAGGCATTCCCTCACCGTCACAATGGCTCCGTGCACGGCTACCCCCATCGT
CGTCATCATCGTCCGCTTGAGCTCAAACGGCCTAGGAGACACTCGACCGGGGAGGCGCTGTCTGGCGGGAAGGAC
GCGAATCGCGGGACGCACATCAACCGGACGAGCAACGCACACGAGCTCATGGAGCGGCAGATGATGAACATGGTC
GCGGACGAGGCGCAGGACCTGGAAATGACCGACTTGGTCGACGATGAGGATTCCGTCATCGTTCCCCCGGTTGCG
GCTCATCGGAAATCAGTCTCGATGATAGACTCGGAACGCAGGGGGATCGAGGGTTCACCCTCCCGAAGAGCGCGA
GTCGATCCGTCGTCGTCCTCGGCCGAAAGACCGATATTGATTCCCTCGACGATAGCATCGGACGTCGAGTTCGCC
GCCGTCGAGCGCGGAACGACGTCGGGCTCGGCGCTGTCGTCGACGTCTGGCCGGCACGACTCGCCGACGAGGAAC
GCGCTGACCAAGATCAGGAACGTCATACAGGACAAGAATAGCGAGACGGGGGATGGAGCCGACGCGAGCCAAGAT
GGGGATCGCCACCCACGGGGCCGAAAGTCGACCTCGTCTCCTGACAAGAAGTGGCGGCGCCCTTCCAGCCCTGCC
AAGCTGCCCGCCTTGGAGCAGCCGTCGGACAGTTCGAGACCGAACAAGAGGTCCAAGAGCATGCGGAACCGATCC
GATAACGGCGGCGTCGGTCTGCGTGGCCTGTTCAAGGGACCTAGGCTCGACACCGTCTTCCGAGGCGGCGTCTTC
CGCCTCAATGGCATGTTATGGAAGAAGGACGGGCCGGTCGAGCCGTCTGCCGCCGAGCCGGACTCGACGGATGAG
TCGGAGGGCGAGAGAACACGTGGTCGGTCGAGGATCTCGCCTCCGCCGCTGCCAGAGAGCCGGCCCGGGCCGCGC
AACTTTCTCGAGTTTATGCCCGAGTTCAGCCACGCACCCGGCGCGCAGTCGCGCAACGCCGGAGAGGGCCGCGGC
AAGGAAACGGCTACGAGCTCGCCGAGCCGGTCGAGTCGGCCGTCGTCGCAGATGGAGCCGCTCAAGGCGCCCCTG
GGCGGTGGCGGCGGTATTCGCAGCGCCTCCGCCTCGCCTTCGCCCTTTGTCGTCGACGTCGGAAACTCTCGTGTT
GCCGACGGCTCCGACGCCTGGGACTCGGAGTCGTACCAGGGCAGCGGTTTGGGTGGCGAGGTGGCGACCGAATCA
GACACGCGGCCCATCGGAGACGAGGCGCAGCCGGCGTCGTCATCGTCGTCGAAGCGGCAGCAGCAGCGGCAGCAG
CAGCAGCACTGGCTCTTGGCGGATAAGGGCCGGACGACGGGGCGGCCCTCGAGGCGGGATATCGCTCGGATCCGG
GCCCTACTTCTCTGCTCCGGCATCAAGGCGCTCGAGATGAACCGCCGCGCCCTCGAAGCGCCCAAGACGGCGACG
GATGTCTACGTCGGCAGCGTCCCGGCCCCGGCTCCCCGTGACATGTACCTCGAAACAGGCCGCCAAATCAGCGCA
GCAAGCCAATCTTCAACGCAAAAATGGCAAGCCTCAGCAGCCCACCTCGCCAGCCAAACCAGCCCAGCTCTCCAC
CAACGCATCGGAGCCGTACGCGCCCGCCTGGTAGACGACCTCTCGGAACTAGCCCGCAAGGCCGCCAACGAAGCC
GACGAAACGGGCCAGGAGCTCGCGCTAGGCCAGCCCCTAAAGGTCAAGCACGTCGTCGACATGATGGACCGCATC
CTGCGACGGAGACACAGGCGTCTCCGCTGGCTGAGGCGCGCTCTCTGGCTCATGGTCGAGTGGTTGCTCGTTGGC
CTCATGTGGTACGTCTGGGCGGTTGTTATGCTGTTGAGGGTTTCGTCGGGGGTAGGGATGGCGGTTTGGAGGGGA
TTGAGGTGGTTGTTTTGGCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail