Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02681
Gene name
Locationscaffold_02:4410892..4412213
Strand-
Gene length (bp)1321
Transcript length (bp)1248
Coding sequence length (bp)1248
Protein length (aa) 416

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10568 Tom37 Outer mitochondrial membrane transport complex protein 1.3E-37 19 141
PF17172 GST_N_4 Glutathione S-transferase N-terminal domain 1.2E-08 18 115

GO

GO Term Description Terminal node
GO:0001401 SAM complex Yes
GO:0005575 cellular_component No
GO:0005742 mitochondrial outer membrane translocase complex No
GO:0032991 protein-containing complex No
GO:0098798 mitochondrial protein-containing complex No
GO:0098799 outer mitochondrial membrane protein complex No
GO:0098796 membrane protein complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 332 354 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02681
MELHVWGPAFGLASVDAECLAAIAYLGCAVGRGGWRLVACSDPSCSPHHHLPSLHHGGVWVSGYGQIVDHLASHF
VHLDRHLDASQRAHVAAYSAFLSAQVAPLVRLSLYVSAANWSATTRPAYSAILPFPLTWTVPPLIRAEAVSHVRQ
LGLAELDADLDPSSSTLNAGRDVLPEALRRRLPATSTKSVRDEMTPEQAAAIRLTAVIEASLSVLDAQLKGRPAL
RFVHDASSVSSLDCLAYGYLALMLKPDVPRAFLRDWILSHAPLLSSFVDAMTPTDLPWLAPEPPTLFASSLRFFD
SLVRNVPTLGEMYADEVTLRARRGIRGLDRRILTLMAVFTAAGLAVGYGFYTYSSLQPFGAASQAWRCCRSGSGP
RYGEFGSMLTGALGLCRAAAYMPFKPAVEGRLIEVDSEVD*
Coding >Ophcf2|02681
ATGGAGCTCCATGTCTGGGGCCCGGCCTTTGGGCTCGCCTCGGTCGACGCCGAGTGTTTGGCTGCCATAGCCTAT
CTTGGCTGCGCCGTGGGTCGAGGCGGTTGGCGGCTGGTTGCCTGCAGTGATCCGTCTTGCAGTCCTCATCATCAT
CTCCCGTCGCTGCATCACGGTGGCGTATGGGTCAGCGGTTATGGCCAGATCGTCGACCATCTCGCTTCCCACTTC
GTCCACCTGGATCGCCATCTGGACGCGTCGCAAAGGGCTCATGTCGCCGCCTATTCCGCCTTCTTGTCCGCTCAA
GTCGCGCCCCTCGTTCGCCTCTCCCTCTATGTCTCGGCCGCAAACTGGTCAGCCACGACGAGACCGGCCTACAGC
GCCATTCTCCCCTTCCCCCTTACTTGGACCGTTCCCCCCTTGATCCGCGCCGAGGCCGTCAGCCACGTTCGTCAG
CTGGGGCTTGCCGAGCTCGACGCCGACTTGGACCCATCCTCGAGTACTCTTAACGCCGGTCGAGATGTCCTGCCC
GAGGCTCTGCGGAGACGGCTGCCTGCCACGTCGACCAAGTCTGTCCGTGACGAGATGACGCCCGAACAGGCGGCT
GCCATCAGGCTCACCGCCGTCATCGAAGCAAGCCTCTCCGTCTTGGACGCCCAGCTCAAGGGCCGTCCGGCTCTC
CGCTTCGTCCACGACGCCTCCTCCGTATCCTCCCTCGATTGCCTGGCCTACGGTTACCTCGCCCTCATGCTCAAG
CCCGACGTACCGCGTGCCTTTCTGCGTGACTGGATCCTCTCCCATGCTCCGCTTCTCAGCAGCTTCGTCGACGCC
ATGACGCCCACAGACCTACCATGGCTCGCCCCCGAACCCCCCACGCTGTTCGCTTCTAGCCTCCGCTTTTTTGAC
TCGCTCGTCCGCAACGTTCCCACGCTCGGCGAGATGTACGCCGACGAGGTGACGCTGCGTGCCAGGCGGGGCATC
CGAGGTCTGGACCGCAGGATTCTGACTTTGATGGCCGTCTTCACGGCTGCTGGCCTGGCCGTCGGCTACGGCTTC
TACACCTACAGCTCTCTTCAGCCGTTTGGTGCTGCCTCCCAAGCGTGGAGGTGCTGCCGGTCCGGGTCCGGGCCG
AGGTACGGCGAGTTCGGATCCATGTTAACCGGCGCTCTGGGGCTCTGCCGGGCCGCCGCATATATGCCGTTTAAG
CCGGCGGTCGAGGGACGCTTAATCGAGGTGGACTCAGAGGTGGACTAG
Transcript >Ophcf2|02681
ATGGAGCTCCATGTCTGGGGCCCGGCCTTTGGGCTCGCCTCGGTCGACGCCGAGTGTTTGGCTGCCATAGCCTAT
CTTGGCTGCGCCGTGGGTCGAGGCGGTTGGCGGCTGGTTGCCTGCAGTGATCCGTCTTGCAGTCCTCATCATCAT
CTCCCGTCGCTGCATCACGGTGGCGTATGGGTCAGCGGTTATGGCCAGATCGTCGACCATCTCGCTTCCCACTTC
GTCCACCTGGATCGCCATCTGGACGCGTCGCAAAGGGCTCATGTCGCCGCCTATTCCGCCTTCTTGTCCGCTCAA
GTCGCGCCCCTCGTTCGCCTCTCCCTCTATGTCTCGGCCGCAAACTGGTCAGCCACGACGAGACCGGCCTACAGC
GCCATTCTCCCCTTCCCCCTTACTTGGACCGTTCCCCCCTTGATCCGCGCCGAGGCCGTCAGCCACGTTCGTCAG
CTGGGGCTTGCCGAGCTCGACGCCGACTTGGACCCATCCTCGAGTACTCTTAACGCCGGTCGAGATGTCCTGCCC
GAGGCTCTGCGGAGACGGCTGCCTGCCACGTCGACCAAGTCTGTCCGTGACGAGATGACGCCCGAACAGGCGGCT
GCCATCAGGCTCACCGCCGTCATCGAAGCAAGCCTCTCCGTCTTGGACGCCCAGCTCAAGGGCCGTCCGGCTCTC
CGCTTCGTCCACGACGCCTCCTCCGTATCCTCCCTCGATTGCCTGGCCTACGGTTACCTCGCCCTCATGCTCAAG
CCCGACGTACCGCGTGCCTTTCTGCGTGACTGGATCCTCTCCCATGCTCCGCTTCTCAGCAGCTTCGTCGACGCC
ATGACGCCCACAGACCTACCATGGCTCGCCCCCGAACCCCCCACGCTGTTCGCTTCTAGCCTCCGCTTTTTTGAC
TCGCTCGTCCGCAACGTTCCCACGCTCGGCGAGATGTACGCCGACGAGGTGACGCTGCGTGCCAGGCGGGGCATC
CGAGGTCTGGACCGCAGGATTCTGACTTTGATGGCCGTCTTCACGGCTGCTGGCCTGGCCGTCGGCTACGGCTTC
TACACCTACAGCTCTCTTCAGCCGTTTGGTGCTGCCTCCCAAGCGTGGAGGTGCTGCCGGTCCGGGTCCGGGCCG
AGGTACGGCGAGTTCGGATCCATGTTAACCGGCGCTCTGGGGCTCTGCCGGGCCGCCGCATATATGCCGTTTAAG
CCGGCGGTCGAGGGACGCTTAATCGAGGTGGACTCAGAGGTGGACTAG
Gene >Ophcf2|02681
ATGGAGCTCCATGTCTGGGGCCCGGCCTTTGGGCTCGCCTCGGTCGACGCCGAGTGTTTGGCTGCCATAGCCTAT
CTTGGCTGCGCCGTGGGTCGAGGCGGTTGGCGGCTGGTTGCCTGCAGTGATCCGTCTTGCAGTCCTCATCGTGGG
TTTTCCCCTGTCTTTCATTTTGACGTCTATGGAGTCTTGGCGCGCGTGACGTTACTGACGGGCTGTAGATCATCT
CCCGTCGCTGCATCACGGTGGCGTATGGGTCAGCGGTTATGGCCAGATCGTCGACCATCTCGCTTCCCACTTCGT
CCACCTGGATCGCCATCTGGACGCGTCGCAAAGGGCTCATGTCGCCGCCTATTCCGCCTTCTTGTCCGCTCAAGT
CGCGCCCCTCGTTCGCCTCTCCCTCTATGTCTCGGCCGCAAACTGGTCAGCCACGACGAGACCGGCCTACAGCGC
CATTCTCCCCTTCCCCCTTACTTGGACCGTTCCCCCCTTGATCCGCGCCGAGGCCGTCAGCCACGTTCGTCAGCT
GGGGCTTGCCGAGCTCGACGCCGACTTGGACCCATCCTCGAGTACTCTTAACGCCGGTCGAGATGTCCTGCCCGA
GGCTCTGCGGAGACGGCTGCCTGCCACGTCGACCAAGTCTGTCCGTGACGAGATGACGCCCGAACAGGCGGCTGC
CATCAGGCTCACCGCCGTCATCGAAGCAAGCCTCTCCGTCTTGGACGCCCAGCTCAAGGGCCGTCCGGCTCTCCG
CTTCGTCCACGACGCCTCCTCCGTATCCTCCCTCGATTGCCTGGCCTACGGTTACCTCGCCCTCATGCTCAAGCC
CGACGTACCGCGTGCCTTTCTGCGTGACTGGATCCTCTCCCATGCTCCGCTTCTCAGCAGCTTCGTCGACGCCAT
GACGCCCACAGACCTACCATGGCTCGCCCCCGAACCCCCCACGCTGTTCGCTTCTAGCCTCCGCTTTTTTGACTC
GCTCGTCCGCAACGTTCCCACGCTCGGCGAGATGTACGCCGACGAGGTGACGCTGCGTGCCAGGCGGGGCATCCG
AGGTCTGGACCGCAGGATTCTGACTTTGATGGCCGTCTTCACGGCTGCTGGCCTGGCCGTCGGCTACGGCTTCTA
CACCTACAGCTCTCTTCAGCCGTTTGGTGCTGCCTCCCAAGCGTGGAGGTGCTGCCGGTCCGGGTCCGGGCCGAG
GTACGGCGAGTTCGGATCCATGTTAACCGGCGCTCTGGGGCTCTGCCGGGCCGCCGCATATATGCCGTTTAAGCC
GGCGGTCGAGGGACGCTTAATCGAGGTGGACTCAGAGGTGGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail