Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02680
Gene name
Locationscaffold_02:4409257..4410696
Strand+
Gene length (bp)1439
Transcript length (bp)1281
Coding sequence length (bp)1281
Protein length (aa) 427

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06728 PIG-U GPI transamidase subunit PIG-U 2.3E-124 16 391

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 89 111 22
3 132 149 17
4 183 205 22
5 226 248 22
6 281 303 22
7 310 329 19
8 352 374 22
9 381 399 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02680
MANTMTLRGKAGVYAAAALLRLFLMVAFPGLSDLLTGRVEISTPMTSFKRLQEGLFLYNHNVSPYDGGVYHQAPL
LLPLFSLLPDVKRWPIFTTVLYILVDVLCADALIAIADSGEAGQSRHFASPRRARRASGLLVAAAFLFNPFTIAT
CMARSTTVFTSCAILHAIARAVQGSPFSALVALSFAAYLSMSPLLLLPPLVLLAWDRRSDRPGPLPSVADFAAKC
LLTVTACLAILVAMSLVVTGNSFDFLARTYGIQLTLSDLTPNVGLWWYFFIEMFDSFRAFFLAVFWLHLSSYVGG
LTIRFRSQPLVVLTLLLGILAIFKPYPCIGDTSLFLAMLPLFWHLFPLMRYTFVASATILYATFLGPAFYHLWIY
AGSGNANFFYAITLVWSLGQSLLVSDLAFAVIRDEWELERPEMVGKDVKQI*
Coding >Ophcf2|02680
ATGGCCAACACCATGACGTTGCGAGGCAAGGCTGGCGTTTACGCCGCCGCTGCACTGCTGCGACTCTTCTTAATG
GTCGCCTTTCCCGGTCTGTCGGATCTGCTGACGGGCCGTGTTGAGATCTCGACGCCAATGACGAGCTTTAAGCGA
CTACAGGAGGGACTCTTTCTCTACAACCACAACGTCTCACCCTATGACGGAGGAGTCTATCATCAGGCGCCGCTG
CTCCTCCCGCTCTTCTCTCTGCTCCCGGACGTCAAGCGCTGGCCCATTTTCACGACGGTGCTTTACATCCTCGTC
GACGTACTCTGCGCAGATGCCCTGATCGCCATCGCCGACTCGGGCGAGGCCGGTCAGTCGCGTCACTTTGCGTCG
CCGCGTCGAGCCCGTCGAGCATCCGGCCTCTTGGTCGCCGCCGCCTTCCTCTTCAATCCTTTCACCATAGCCACA
TGCATGGCCCGCTCGACAACCGTCTTCACCTCATGCGCCATCCTCCACGCCATCGCCAGGGCCGTCCAAGGCTCT
CCCTTTAGCGCCCTCGTGGCCCTCTCCTTCGCCGCCTACCTCTCCATGTCCCCGCTGCTGCTCCTCCCGCCTCTC
GTCCTCCTGGCTTGGGACCGCCGCTCAGACCGGCCCGGCCCGTTGCCGTCCGTCGCCGACTTCGCCGCAAAGTGC
CTTCTCACCGTGACCGCCTGTCTTGCCATCTTGGTGGCCATGTCGCTCGTCGTGACGGGGAACTCGTTCGACTTC
CTGGCCCGCACCTACGGCATCCAGCTGACGCTCTCGGACCTGACGCCCAACGTTGGCCTTTGGTGGTATTTCTTC
ATCGAGATGTTCGACTCCTTCCGTGCCTTCTTCCTCGCCGTCTTCTGGCTGCACCTGTCATCGTACGTCGGCGGC
CTCACCATTCGATTCCGGTCCCAGCCTCTCGTCGTCCTCACCCTGCTACTCGGAATCCTCGCCATCTTCAAGCCC
TACCCCTGCATCGGGGACACCAGCCTGTTCCTGGCCATGCTGCCGCTCTTCTGGCACCTGTTTCCCCTCATGCGC
TACACCTTTGTGGCCTCCGCCACCATCCTGTACGCCACCTTTCTCGGCCCGGCCTTTTACCACCTCTGGATCTAC
GCCGGCAGCGGCAACGCAAACTTTTTCTACGCCATCACCTTGGTTTGGAGTCTGGGCCAGAGCTTGCTTGTGTCG
GATCTGGCATTCGCCGTCATCAGAGACGAGTGGGAGTTGGAGAGGCCCGAGATGGTAGGGAAGGACGTCAAGCAG
ATCTAG
Transcript >Ophcf2|02680
ATGGCCAACACCATGACGTTGCGAGGCAAGGCTGGCGTTTACGCCGCCGCTGCACTGCTGCGACTCTTCTTAATG
GTCGCCTTTCCCGGTCTGTCGGATCTGCTGACGGGCCGTGTTGAGATCTCGACGCCAATGACGAGCTTTAAGCGA
CTACAGGAGGGACTCTTTCTCTACAACCACAACGTCTCACCCTATGACGGAGGAGTCTATCATCAGGCGCCGCTG
CTCCTCCCGCTCTTCTCTCTGCTCCCGGACGTCAAGCGCTGGCCCATTTTCACGACGGTGCTTTACATCCTCGTC
GACGTACTCTGCGCAGATGCCCTGATCGCCATCGCCGACTCGGGCGAGGCCGGTCAGTCGCGTCACTTTGCGTCG
CCGCGTCGAGCCCGTCGAGCATCCGGCCTCTTGGTCGCCGCCGCCTTCCTCTTCAATCCTTTCACCATAGCCACA
TGCATGGCCCGCTCGACAACCGTCTTCACCTCATGCGCCATCCTCCACGCCATCGCCAGGGCCGTCCAAGGCTCT
CCCTTTAGCGCCCTCGTGGCCCTCTCCTTCGCCGCCTACCTCTCCATGTCCCCGCTGCTGCTCCTCCCGCCTCTC
GTCCTCCTGGCTTGGGACCGCCGCTCAGACCGGCCCGGCCCGTTGCCGTCCGTCGCCGACTTCGCCGCAAAGTGC
CTTCTCACCGTGACCGCCTGTCTTGCCATCTTGGTGGCCATGTCGCTCGTCGTGACGGGGAACTCGTTCGACTTC
CTGGCCCGCACCTACGGCATCCAGCTGACGCTCTCGGACCTGACGCCCAACGTTGGCCTTTGGTGGTATTTCTTC
ATCGAGATGTTCGACTCCTTCCGTGCCTTCTTCCTCGCCGTCTTCTGGCTGCACCTGTCATCGTACGTCGGCGGC
CTCACCATTCGATTCCGGTCCCAGCCTCTCGTCGTCCTCACCCTGCTACTCGGAATCCTCGCCATCTTCAAGCCC
TACCCCTGCATCGGGGACACCAGCCTGTTCCTGGCCATGCTGCCGCTCTTCTGGCACCTGTTTCCCCTCATGCGC
TACACCTTTGTGGCCTCCGCCACCATCCTGTACGCCACCTTTCTCGGCCCGGCCTTTTACCACCTCTGGATCTAC
GCCGGCAGCGGCAACGCAAACTTTTTCTACGCCATCACCTTGGTTTGGAGTCTGGGCCAGAGCTTGCTTGTGTCG
GATCTGGCATTCGCCGTCATCAGAGACGAGTGGGAGTTGGAGAGGCCCGAGATGGTAGGGAAGGACGTCAAGCAG
ATCTAG
Gene >Ophcf2|02680
ATGGCCAACACCATGACGTTGCGAGGCAAGGCTGGCGTTTACGCCGCCGCTGCACTGCTGCGACTCTTCTTAATG
GTCGCCTTTCCCGGTCTGTCGGATCTGCTGACGGGCCGTGTTGAGATCTCGACGCCAATGACGAGCTTTAAGCGA
CGTGAGTCTCGCCTTCGTGTCTTGACGACGGCTTCATTGTTGACAGGGTTGCTTCATCGCAGTACAGGAGGGACT
CTTTCTCTACAACCACAACGTCTCACCCTATGACGGAGGAGTCTATCATCAGGCGCCGCTGCTCCTCCCGCTCTT
CTCTCTGCTCCCGGACGTCAAGCGCTGGCCCATTTTCACGACGGTGCTTTACATCCTCGTCGACGTACTCTGCGC
AGATGCCCTGATCGCCATCGCCGACTCGGGCGAGGCCGGTCAGTCGCGTCACTTTGCGTCGCCGCGTCGAGCCCG
TCGAGCATCCGGCCTCTTGGTCGCCGCCGCGTGAGTCCTTTTCTCTCTTCCCTTGCCCTTTACCTCTCATCACGT
CCTTTTTCCCCTGTCCAAAAGCTCAACGGCCAACACGTACCAACGTCAATAGCTTCCTCTTCAATCCTTTCACCA
TAGCCACATGCATGGCCCGCTCGACAACCGTCTTCACCTCATGCGCCATCCTCCACGCCATCGCCAGGGCCGTCC
AAGGCTCTCCCTTTAGCGCCCTCGTGGCCCTCTCCTTCGCCGCCTACCTCTCCATGTCCCCGCTGCTGCTCCTCC
CGCCTCTCGTCCTCCTGGCTTGGGACCGCCGCTCAGACCGGCCCGGCCCGTTGCCGTCCGTCGCCGACTTCGCCG
CAAAGTGCCTTCTCACCGTGACCGCCTGTCTTGCCATCTTGGTGGCCATGTCGCTCGTCGTGACGGGGAACTCGT
TCGACTTCCTGGCCCGCACCTACGGCATCCAGCTGACGCTCTCGGACCTGACGCCCAACGTTGGCCTTTGGTGGT
ATTTCTTCATCGAGATGTTCGACTCCTTCCGTGCCTTCTTCCTCGCCGTCTTCTGGCTGCACCTGTCATCGTACG
TCGGCGGCCTCACCATTCGATTCCGGTCCCAGCCTCTCGTCGTCCTCACCCTGCTACTCGGAATCCTCGCCATCT
TCAAGCCCTACCCCTGCATCGGGGACACCAGCCTGTTCCTGGCCATGCTGCCGCTCTTCTGGCACCTGTTTCCCC
TCATGCGCTACACCTTTGTGGCCTCCGCCACCATCCTGTACGCCACCTTTCTCGGCCCGGCCTTTTACCACCTCT
GGATCTACGCCGGCAGCGGCAACGCAAACTTTTTCTACGCCATCACCTTGGTTTGGAGTCTGGGCCAGAGCTTGC
TTGTGTCGGATCTGGCATTCGCCGTCATCAGAGACGAGTGGGAGTTGGAGAGGCCCGAGATGGTAGGGAAGGACG
TCAAGCAGATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail