Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02677
Gene name
Locationscaffold_02:4398913..4404675
Strand+
Gene length (bp)5762
Transcript length (bp)5334
Coding sequence length (bp)5334
Protein length (aa) 1778

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00225 Kinesin Kinesin motor domain 1.9E-104 674 1000
PF03676 PHAF1 Phagosome assembly factor 1 6.0E-30 17 292
PF03676 PHAF1 Phagosome assembly factor 1 5.4E-17 353 525
PF16796 Microtub_bd Microtubule binding 2.1E-23 669 819

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0007018 microtubule-based movement Yes
GO:0003777 microtubule motor activity Yes
GO:0008017 microtubule binding Yes
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0007017 microtubule-based process No
GO:0032559 adenyl ribonucleotide binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0015631 tubulin binding No
GO:0140657 ATP-dependent activity No
GO:0008092 cytoskeletal protein binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0003774 cytoskeletal motor activity No
GO:0000166 nucleotide binding No
GO:0005515 protein binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.6741 0.5564 0.0913 0.1033 0.2165 0.0555 0.2493 0.266 0.2105 0.0913

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup146
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4387
Ophiocordyceps australis 1348a (Ghana) OphauG2|5166
Ophiocordyceps australis map64 (Brazil) OphauB2|6091
Ophiocordyceps australis map64 (Brazil) OphauB2|6092
Ophiocordyceps australis map64 (Brazil) OphauB2|6093
Ophiocordyceps australis map64 (Brazil) OphauB2|87
Ophiocordyceps camponoti-floridani Ophcf2|02677 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4371
Ophiocordyceps kimflemingae Ophio5|2062
Ophiocordyceps kimflemingae Ophio5|4888
Ophiocordyceps kimflemingae Ophio5|8395
Ophiocordyceps subramaniannii Hirsu2|5226
Ophiocordyceps subramaniannii Hirsu2|9012

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02677
MSLFTAQLHPGRALGFLALGASLHDVLTRLKAEPQRFPKLEVVFSSERPVTEPVCVVLPHNGIRLRFDGSEQRLR
LIEVTDFTKNHITFKDRDLLKPAANGVTATGTPSSTALGPSFRHIYHRVLGPTYAGEFIPPRSGGGDGIYVLSYP
GVAFNFALAEAAYSPDKDVVTLLAAASSQAATSMAVFSGDSWSEARPSLWTGPLPNVRLPSSVVASGGGGVRSRD
SYPDEVSLVKLRGGGRIDMLRKWTGSGPVFRLQLGETTPQDLVMALGPPSAIYRKNDQKMVIHTMRAAPVDGARV
SASVAVKTGDAELTDTDQSSMNTASDESDEAAAGDGVNEDGDDHGGGTGDGSPAGECFYNYFYLGFDVLLSTPTP
GKANLGTSSGIKNQHSDRLVAKKLVLHGNIPGCYEFNRHRRCRWELRPEGGGETDDDAIADSETEFKTIEERLAR
HWGSDAARHRGMVLNRGWGDSPGSSCEFLGGWEESGGGRRAEAGGGGDSTTTLYGFPGLVFEVLRNGFVNTLSLF
VCVITAIFLLLFSISASASGSSQDSNPVSVSCVAVSVATGLEDDQLIPVVAVASRRQQTRPDREAAGRRAVPSMR
SGATGRGGGRTGVMRAPSTAAVRPSTSSAGAVRSVSSSSARQGGGSPRAKRKERESSTEAGAAIEGSNINVVVRC
RGRSEREVREGSPVVLRTDGVKGKVVELSTGAHALSNKTYSFDRVFSAAADQNMVFDDVVKPILDDMLAGYNCTV
FAYGQTGTGKTYTMSGDMEETTPGMVSEEAGIIPRALQHLFNRLELGEAESCVKCSFIELYNEELRDLLAAEETR
LKMFDDAARKTTVIQGMEERHIADAAQGLRVLRQGSVRRQVAATKCNDLSSRGHTVFTVTAYVKGEGDDDVVAAG
KLNLVDLAGSENIQRSGAEKLRAAEAGLINKSLLTLGRVINALVDGGAHIPYRESKLTRLLQDSLGGRTKTCIIA
TVSPARSNLEETMSTLDYAFRAKNIRNRPQLNAPLNKKMLLRDFAAEIERLKADLIATRQRNGVYLAIDAYDDMT
AQSESRRIVVDEQAAKIETLESNLRNKVQDLFSMTSAFMGLRRDHDATKQQLDETRGLLDRADIVVAATKASLAR
ETQRRLAHAETEERLAAMGGELVDTLRRTVGDVDGLHAKVRRRSDLHALNRSAWADGQAHVASITAAVERRLDDF
RQAHLRHVASVGDRLDGLVADQLRGLDATRALLDGHVVALDESSRLGRELRQRASEDEAALLDAVADVRDSLKMH
LAESLKVVSRAAEAISADVLHDMTTFHATLHDSYSSLGKDFKSIFDDLVRHMTAQRSEADGLRRQLQTAAAAAAL
QNASAAARIQEALDEERRQAAEERQKLTAQVTSLLAAQGEAHEARMTERACMLHRAVADCGASLEAAASQHGRGM
DAWDEREARLLEEVRRSRDQVKAKLKDDWAAAGEQSAAMQKTARAVHAETSRVVDEQVDGLDAQMELLDRLVARA
RTEKTTHDSERTQAALVQAQAVEQSAAMVATQLQAVADDVRDSGEEIAAETERLAEEVEPLDELVRKPLEDLRFG
LGGLALKEYQPTGKTPQKVVYTFPTALPRTEAIEEDEGEEDEVMMEGRGSIGGEDLDDEVDDEDGHDDSHIDLHL
DLLLPHPPPPPPPPPPPTQQDRRPSIVLASNSLLLPPTSAPPQPTRSQFLLLNNSIVNNSDRGRGWRNKVIGIST
SPHAPLCRPAQEAYAVVGQGEDAGGEGECAAFGGGGGEEEESEVELTVMASS*
Coding >Ophcf2|02677
ATGTCCCTGTTCACGGCGCAGCTGCACCCCGGGCGAGCGCTCGGATTCTTGGCGCTTGGGGCATCGTTGCACGAC
GTACTGACGCGGCTCAAGGCGGAGCCACAGCGGTTTCCGAAGCTCGAGGTGGTGTTTTCGTCCGAGAGACCGGTG
ACGGAGCCGGTGTGCGTGGTGCTGCCCCATAACGGCATCCGACTGCGTTTCGACGGGTCTGAACAGCGACTACGA
CTCATCGAGGTGACCGATTTCACGAAGAACCACATCACCTTCAAGGACCGAGACTTGCTAAAGCCTGCGGCTAAC
GGGGTGACAGCGACGGGCACACCGTCGTCAACGGCGCTCGGCCCATCTTTTCGACACATCTACCACCGGGTTTTG
GGGCCGACATACGCGGGCGAATTCATCCCGCCGAGGTCTGGGGGTGGAGATGGTATCTACGTGCTGTCGTATCCA
GGCGTGGCCTTCAACTTCGCTCTGGCAGAGGCGGCCTATTCGCCGGATAAGGACGTGGTTACGCTACTGGCGGCG
GCATCCAGCCAGGCGGCCACGTCCATGGCCGTCTTCAGCGGCGACTCTTGGTCCGAAGCGCGGCCGAGCTTGTGG
ACGGGCCCGTTGCCGAACGTGAGGCTGCCATCGTCGGTCGTCGCGAGCGGCGGCGGCGGAGTGCGGTCGCGAGAC
TCTTACCCGGACGAGGTGTCCCTGGTCAAACTCCGCGGCGGCGGGCGCATCGACATGTTGCGCAAGTGGACGGGC
TCAGGACCCGTCTTTCGGCTGCAGTTGGGGGAGACGACGCCGCAGGATCTCGTCATGGCGCTGGGACCGCCGAGT
GCCATCTACCGAAAGAACGATCAGAAGATGGTTATCCACACGATGCGCGCTGCTCCTGTCGACGGCGCACGGGTG
TCGGCGTCGGTAGCTGTCAAAACGGGAGACGCCGAGCTGACGGATACGGATCAGTCATCGATGAACACGGCATCG
GACGAGTCGGACGAAGCGGCAGCGGGTGACGGCGTTAATGAAGACGGTGACGATCACGGCGGAGGGACTGGAGAT
GGAAGTCCCGCAGGCGAGTGCTTCTACAACTACTTTTACCTCGGCTTTGACGTTCTCCTCTCGACGCCCACGCCC
GGGAAAGCCAACTTGGGCACAAGCAGCGGCATCAAGAACCAGCATTCCGATCGGCTCGTAGCGAAAAAGCTGGTA
TTGCACGGCAACATCCCGGGCTGCTACGAGTTTAACCGGCACCGCCGATGCAGATGGGAGCTGCGCCCAGAAGGT
GGAGGCGAAACCGACGATGACGCCATCGCGGACTCGGAGACGGAGTTCAAGACGATCGAGGAGCGTCTCGCGAGA
CACTGGGGCTCCGACGCAGCGCGGCACAGGGGTATGGTCCTCAACCGTGGCTGGGGCGACAGTCCGGGCAGTAGC
TGCGAGTTTCTCGGCGGCTGGGAGGAGAGCGGCGGTGGGAGGAGGGCCGAGGCCGGAGGAGGGGGGGACTCGACG
ACGACGCTGTACGGGTTTCCGGGGTTGGTTTTTGAGGTGCTCCGGAATGGCTTCGTGAATACTCTGTCCCTGTTT
GTCTGCGTGATCACGGCTATTTTTCTCCTGCTCTTCTCCATCTCAGCCTCAGCTTCAGGCTCGTCGCAAGATAGC
AACCCAGTTTCGGTGTCTTGCGTCGCGGTCTCGGTTGCGACCGGCTTAGAAGACGACCAACTGATACCCGTCGTG
GCAGTGGCTTCCCGGCGACAACAGACGCGTCCCGACCGCGAGGCGGCGGGTCGCCGCGCGGTGCCGAGCATGAGG
TCCGGAGCGACAGGCCGAGGCGGAGGGCGAACGGGCGTCATGCGGGCGCCTTCAACCGCTGCCGTACGGCCATCG
ACATCATCGGCCGGCGCTGTCCGATCCGTGTCATCCTCGTCGGCCCGACAAGGCGGCGGGTCACCGAGGGCGAAG
CGCAAAGAACGCGAGTCATCGACGGAAGCGGGCGCTGCGATCGAGGGCAGTAACATTAATGTCGTGGTCCGGTGC
CGCGGACGCAGTGAGCGCGAGGTGCGCGAGGGGAGTCCCGTCGTGCTGAGGACGGATGGCGTCAAGGGCAAGGTG
GTGGAGCTGTCGACGGGGGCGCACGCGCTCAGCAACAAGACGTACAGCTTCGACCGGGTGTTTTCTGCGGCGGCG
GACCAGAACATGGTGTTTGACGACGTGGTCAAGCCGATACTGGACGACATGCTGGCCGGCTACAACTGCACCGTC
TTCGCATACGGGCAGACGGGCACGGGCAAGACGTACACCATGTCGGGCGACATGGAGGAGACGACGCCGGGCATG
GTGTCGGAGGAGGCAGGCATCATCCCGCGAGCGCTACAGCACCTTTTCAACCGGCTGGAGCTGGGCGAGGCTGAG
AGCTGCGTCAAGTGCTCCTTTATCGAGCTGTACAACGAGGAGCTGCGCGATCTTCTGGCAGCCGAGGAGACGAGG
CTCAAGATGTTCGACGACGCGGCCCGCAAGACGACGGTGATTCAGGGCATGGAGGAGCGGCACATCGCCGACGCG
GCTCAAGGTCTTCGCGTGCTACGGCAGGGCAGCGTGAGGAGACAGGTGGCGGCCACCAAGTGCAACGACCTGAGC
TCGCGCGGCCACACAGTCTTCACCGTAACGGCCTACGTCAAGGGAGAGGGCGACGATGACGTCGTGGCCGCCGGC
AAGCTCAACCTGGTGGATCTGGCCGGGTCGGAGAATATCCAGCGGTCCGGGGCCGAGAAGCTGCGGGCGGCCGAG
GCCGGGCTCATCAACAAGTCGCTGCTCACGCTGGGGCGCGTCATCAACGCTCTGGTCGACGGCGGCGCTCACATC
CCCTACCGCGAATCCAAGCTGACGCGGCTACTGCAAGACTCGCTGGGCGGACGGACCAAGACGTGCATCATCGCG
ACGGTATCGCCGGCGAGAAGCAACCTCGAGGAGACCATGTCGACGCTCGACTACGCCTTTCGCGCAAAGAATATC
CGCAACCGGCCGCAGCTCAACGCGCCGCTCAACAAGAAGATGCTGCTGCGCGACTTCGCCGCCGAGATTGAGCGC
CTCAAGGCTGATCTCATCGCGACGCGGCAGCGCAATGGAGTGTACCTGGCCATCGACGCCTACGATGACATGACG
GCCCAGAGCGAGTCGCGTCGCATTGTCGTCGACGAGCAGGCGGCCAAGATCGAGACGCTCGAGTCGAACCTGCGC
AACAAGGTGCAGGATCTGTTCTCCATGACGTCGGCCTTTATGGGCCTTCGCCGCGATCACGACGCCACCAAGCAG
CAGCTGGACGAGACGCGCGGCCTGCTCGATCGTGCCGACATCGTCGTCGCAGCCACCAAGGCCTCGCTGGCCAGG
GAGACGCAGCGACGCCTGGCCCACGCCGAGACGGAGGAGCGTCTGGCGGCCATGGGCGGCGAGCTGGTCGACACG
CTTCGCCGCACCGTCGGCGATGTCGACGGCCTTCACGCCAAGGTCCGCCGTCGCTCCGACCTGCACGCGCTGAAC
CGGTCCGCCTGGGCAGACGGACAGGCACATGTCGCCAGCATTACCGCCGCCGTGGAGCGCCGCCTGGACGACTTT
CGCCAAGCTCATCTGCGGCACGTGGCGTCCGTGGGCGATAGGCTCGATGGTCTGGTGGCCGATCAGCTGCGTGGG
TTGGACGCGACGCGCGCCCTGTTGGATGGTCATGTCGTTGCCCTGGATGAGTCGAGCCGGCTCGGGCGGGAGCTG
CGGCAGCGGGCCAGTGAGGATGAGGCCGCCTTGCTGGATGCCGTGGCCGATGTGCGCGACTCGCTCAAGATGCAT
CTGGCCGAGAGTCTGAAGGTTGTGTCTCGAGCAGCCGAGGCCATCTCTGCCGACGTGCTTCACGACATGACGACC
TTTCACGCGACGCTCCACGACTCGTACAGCTCGCTCGGCAAGGACTTCAAATCCATCTTCGACGACCTCGTCCGC
CACATGACAGCCCAGCGAAGCGAGGCCGACGGTCTTCGGCGTCAGCTCCAGACCGCAGCCGCAGCCGCCGCGCTT
CAAAATGCCTCAGCAGCCGCGCGTATCCAGGAAGCGCTGGACGAGGAGAGACGCCAAGCAGCTGAGGAACGGCAG
AAGCTCACGGCACAGGTCACAAGCCTGCTGGCTGCTCAAGGCGAGGCGCACGAAGCTCGCATGACGGAGCGGGCT
TGCATGCTGCACCGCGCCGTAGCCGACTGCGGCGCCTCTCTCGAAGCGGCCGCATCACAGCACGGCCGCGGTATG
GACGCATGGGACGAGCGCGAGGCCCGTCTGCTGGAAGAGGTGCGCCGATCTCGTGATCAGGTAAAGGCCAAGCTC
AAGGACGACTGGGCCGCGGCCGGCGAGCAGAGTGCGGCGATGCAGAAGACGGCCAGAGCGGTTCACGCCGAGACA
TCTCGCGTCGTCGACGAGCAGGTCGATGGCCTAGATGCGCAGATGGAGCTTCTCGACCGGCTGGTAGCCCGCGCC
CGGACGGAAAAGACAACTCACGACTCGGAGCGTACGCAGGCAGCCCTCGTCCAAGCCCAGGCCGTCGAGCAGTCC
GCCGCCATGGTGGCGACGCAACTCCAGGCCGTGGCCGATGACGTCAGGGATTCGGGCGAGGAGATTGCGGCCGAG
ACGGAGCGGTTGGCCGAAGAGGTCGAGCCGCTGGATGAGCTGGTCAGGAAGCCGCTCGAAGACCTGAGGTTCGGG
CTCGGAGGGCTGGCGTTGAAGGAGTATCAGCCGACGGGGAAGACGCCTCAGAAGGTGGTGTATACTTTTCCGACG
GCGTTGCCTAGGACCGAGGCCATTGAGGAGGATGAGGGTGAGGAGGATGAGGTGATGATGGAGGGGAGAGGATCG
ATTGGGGGGGAGGATCTTGACGATGAGGTTGATGACGAGGATGGCCACGACGACAGCCACATCGATCTTCATCTC
GATCTCCTACTCCCACACCCTCCGCCTCCGCCTCCGCCTCCGCCTCCCCCTACCCAACAAGACCGCCGCCCCTCC
ATCGTCCTAGCAAGCAACAGCCTCCTCCTCCCCCCGACCTCCGCCCCCCCTCAGCCAACGAGAAGTCAATTCCTC
CTCCTCAACAATAGCATCGTCAACAACAGCGACAGGGGTAGGGGCTGGAGGAACAAGGTCATCGGCATCAGCACC
AGCCCTCACGCCCCCCTCTGCCGTCCCGCTCAAGAGGCCTACGCGGTCGTCGGCCAGGGCGAGGATGCTGGAGGG
GAGGGAGAATGTGCCGCCTTTGGAGGTGGGGGAGGGGAGGAGGAAGAGTCCGAGGTTGAATTGACGGTTATGGCT
TCGTCTTGA
Transcript >Ophcf2|02677
ATGTCCCTGTTCACGGCGCAGCTGCACCCCGGGCGAGCGCTCGGATTCTTGGCGCTTGGGGCATCGTTGCACGAC
GTACTGACGCGGCTCAAGGCGGAGCCACAGCGGTTTCCGAAGCTCGAGGTGGTGTTTTCGTCCGAGAGACCGGTG
ACGGAGCCGGTGTGCGTGGTGCTGCCCCATAACGGCATCCGACTGCGTTTCGACGGGTCTGAACAGCGACTACGA
CTCATCGAGGTGACCGATTTCACGAAGAACCACATCACCTTCAAGGACCGAGACTTGCTAAAGCCTGCGGCTAAC
GGGGTGACAGCGACGGGCACACCGTCGTCAACGGCGCTCGGCCCATCTTTTCGACACATCTACCACCGGGTTTTG
GGGCCGACATACGCGGGCGAATTCATCCCGCCGAGGTCTGGGGGTGGAGATGGTATCTACGTGCTGTCGTATCCA
GGCGTGGCCTTCAACTTCGCTCTGGCAGAGGCGGCCTATTCGCCGGATAAGGACGTGGTTACGCTACTGGCGGCG
GCATCCAGCCAGGCGGCCACGTCCATGGCCGTCTTCAGCGGCGACTCTTGGTCCGAAGCGCGGCCGAGCTTGTGG
ACGGGCCCGTTGCCGAACGTGAGGCTGCCATCGTCGGTCGTCGCGAGCGGCGGCGGCGGAGTGCGGTCGCGAGAC
TCTTACCCGGACGAGGTGTCCCTGGTCAAACTCCGCGGCGGCGGGCGCATCGACATGTTGCGCAAGTGGACGGGC
TCAGGACCCGTCTTTCGGCTGCAGTTGGGGGAGACGACGCCGCAGGATCTCGTCATGGCGCTGGGACCGCCGAGT
GCCATCTACCGAAAGAACGATCAGAAGATGGTTATCCACACGATGCGCGCTGCTCCTGTCGACGGCGCACGGGTG
TCGGCGTCGGTAGCTGTCAAAACGGGAGACGCCGAGCTGACGGATACGGATCAGTCATCGATGAACACGGCATCG
GACGAGTCGGACGAAGCGGCAGCGGGTGACGGCGTTAATGAAGACGGTGACGATCACGGCGGAGGGACTGGAGAT
GGAAGTCCCGCAGGCGAGTGCTTCTACAACTACTTTTACCTCGGCTTTGACGTTCTCCTCTCGACGCCCACGCCC
GGGAAAGCCAACTTGGGCACAAGCAGCGGCATCAAGAACCAGCATTCCGATCGGCTCGTAGCGAAAAAGCTGGTA
TTGCACGGCAACATCCCGGGCTGCTACGAGTTTAACCGGCACCGCCGATGCAGATGGGAGCTGCGCCCAGAAGGT
GGAGGCGAAACCGACGATGACGCCATCGCGGACTCGGAGACGGAGTTCAAGACGATCGAGGAGCGTCTCGCGAGA
CACTGGGGCTCCGACGCAGCGCGGCACAGGGGTATGGTCCTCAACCGTGGCTGGGGCGACAGTCCGGGCAGTAGC
TGCGAGTTTCTCGGCGGCTGGGAGGAGAGCGGCGGTGGGAGGAGGGCCGAGGCCGGAGGAGGGGGGGACTCGACG
ACGACGCTGTACGGGTTTCCGGGGTTGGTTTTTGAGGTGCTCCGGAATGGCTTCGTGAATACTCTGTCCCTGTTT
GTCTGCGTGATCACGGCTATTTTTCTCCTGCTCTTCTCCATCTCAGCCTCAGCTTCAGGCTCGTCGCAAGATAGC
AACCCAGTTTCGGTGTCTTGCGTCGCGGTCTCGGTTGCGACCGGCTTAGAAGACGACCAACTGATACCCGTCGTG
GCAGTGGCTTCCCGGCGACAACAGACGCGTCCCGACCGCGAGGCGGCGGGTCGCCGCGCGGTGCCGAGCATGAGG
TCCGGAGCGACAGGCCGAGGCGGAGGGCGAACGGGCGTCATGCGGGCGCCTTCAACCGCTGCCGTACGGCCATCG
ACATCATCGGCCGGCGCTGTCCGATCCGTGTCATCCTCGTCGGCCCGACAAGGCGGCGGGTCACCGAGGGCGAAG
CGCAAAGAACGCGAGTCATCGACGGAAGCGGGCGCTGCGATCGAGGGCAGTAACATTAATGTCGTGGTCCGGTGC
CGCGGACGCAGTGAGCGCGAGGTGCGCGAGGGGAGTCCCGTCGTGCTGAGGACGGATGGCGTCAAGGGCAAGGTG
GTGGAGCTGTCGACGGGGGCGCACGCGCTCAGCAACAAGACGTACAGCTTCGACCGGGTGTTTTCTGCGGCGGCG
GACCAGAACATGGTGTTTGACGACGTGGTCAAGCCGATACTGGACGACATGCTGGCCGGCTACAACTGCACCGTC
TTCGCATACGGGCAGACGGGCACGGGCAAGACGTACACCATGTCGGGCGACATGGAGGAGACGACGCCGGGCATG
GTGTCGGAGGAGGCAGGCATCATCCCGCGAGCGCTACAGCACCTTTTCAACCGGCTGGAGCTGGGCGAGGCTGAG
AGCTGCGTCAAGTGCTCCTTTATCGAGCTGTACAACGAGGAGCTGCGCGATCTTCTGGCAGCCGAGGAGACGAGG
CTCAAGATGTTCGACGACGCGGCCCGCAAGACGACGGTGATTCAGGGCATGGAGGAGCGGCACATCGCCGACGCG
GCTCAAGGTCTTCGCGTGCTACGGCAGGGCAGCGTGAGGAGACAGGTGGCGGCCACCAAGTGCAACGACCTGAGC
TCGCGCGGCCACACAGTCTTCACCGTAACGGCCTACGTCAAGGGAGAGGGCGACGATGACGTCGTGGCCGCCGGC
AAGCTCAACCTGGTGGATCTGGCCGGGTCGGAGAATATCCAGCGGTCCGGGGCCGAGAAGCTGCGGGCGGCCGAG
GCCGGGCTCATCAACAAGTCGCTGCTCACGCTGGGGCGCGTCATCAACGCTCTGGTCGACGGCGGCGCTCACATC
CCCTACCGCGAATCCAAGCTGACGCGGCTACTGCAAGACTCGCTGGGCGGACGGACCAAGACGTGCATCATCGCG
ACGGTATCGCCGGCGAGAAGCAACCTCGAGGAGACCATGTCGACGCTCGACTACGCCTTTCGCGCAAAGAATATC
CGCAACCGGCCGCAGCTCAACGCGCCGCTCAACAAGAAGATGCTGCTGCGCGACTTCGCCGCCGAGATTGAGCGC
CTCAAGGCTGATCTCATCGCGACGCGGCAGCGCAATGGAGTGTACCTGGCCATCGACGCCTACGATGACATGACG
GCCCAGAGCGAGTCGCGTCGCATTGTCGTCGACGAGCAGGCGGCCAAGATCGAGACGCTCGAGTCGAACCTGCGC
AACAAGGTGCAGGATCTGTTCTCCATGACGTCGGCCTTTATGGGCCTTCGCCGCGATCACGACGCCACCAAGCAG
CAGCTGGACGAGACGCGCGGCCTGCTCGATCGTGCCGACATCGTCGTCGCAGCCACCAAGGCCTCGCTGGCCAGG
GAGACGCAGCGACGCCTGGCCCACGCCGAGACGGAGGAGCGTCTGGCGGCCATGGGCGGCGAGCTGGTCGACACG
CTTCGCCGCACCGTCGGCGATGTCGACGGCCTTCACGCCAAGGTCCGCCGTCGCTCCGACCTGCACGCGCTGAAC
CGGTCCGCCTGGGCAGACGGACAGGCACATGTCGCCAGCATTACCGCCGCCGTGGAGCGCCGCCTGGACGACTTT
CGCCAAGCTCATCTGCGGCACGTGGCGTCCGTGGGCGATAGGCTCGATGGTCTGGTGGCCGATCAGCTGCGTGGG
TTGGACGCGACGCGCGCCCTGTTGGATGGTCATGTCGTTGCCCTGGATGAGTCGAGCCGGCTCGGGCGGGAGCTG
CGGCAGCGGGCCAGTGAGGATGAGGCCGCCTTGCTGGATGCCGTGGCCGATGTGCGCGACTCGCTCAAGATGCAT
CTGGCCGAGAGTCTGAAGGTTGTGTCTCGAGCAGCCGAGGCCATCTCTGCCGACGTGCTTCACGACATGACGACC
TTTCACGCGACGCTCCACGACTCGTACAGCTCGCTCGGCAAGGACTTCAAATCCATCTTCGACGACCTCGTCCGC
CACATGACAGCCCAGCGAAGCGAGGCCGACGGTCTTCGGCGTCAGCTCCAGACCGCAGCCGCAGCCGCCGCGCTT
CAAAATGCCTCAGCAGCCGCGCGTATCCAGGAAGCGCTGGACGAGGAGAGACGCCAAGCAGCTGAGGAACGGCAG
AAGCTCACGGCACAGGTCACAAGCCTGCTGGCTGCTCAAGGCGAGGCGCACGAAGCTCGCATGACGGAGCGGGCT
TGCATGCTGCACCGCGCCGTAGCCGACTGCGGCGCCTCTCTCGAAGCGGCCGCATCACAGCACGGCCGCGGTATG
GACGCATGGGACGAGCGCGAGGCCCGTCTGCTGGAAGAGGTGCGCCGATCTCGTGATCAGGTAAAGGCCAAGCTC
AAGGACGACTGGGCCGCGGCCGGCGAGCAGAGTGCGGCGATGCAGAAGACGGCCAGAGCGGTTCACGCCGAGACA
TCTCGCGTCGTCGACGAGCAGGTCGATGGCCTAGATGCGCAGATGGAGCTTCTCGACCGGCTGGTAGCCCGCGCC
CGGACGGAAAAGACAACTCACGACTCGGAGCGTACGCAGGCAGCCCTCGTCCAAGCCCAGGCCGTCGAGCAGTCC
GCCGCCATGGTGGCGACGCAACTCCAGGCCGTGGCCGATGACGTCAGGGATTCGGGCGAGGAGATTGCGGCCGAG
ACGGAGCGGTTGGCCGAAGAGGTCGAGCCGCTGGATGAGCTGGTCAGGAAGCCGCTCGAAGACCTGAGGTTCGGG
CTCGGAGGGCTGGCGTTGAAGGAGTATCAGCCGACGGGGAAGACGCCTCAGAAGGTGGTGTATACTTTTCCGACG
GCGTTGCCTAGGACCGAGGCCATTGAGGAGGATGAGGGTGAGGAGGATGAGGTGATGATGGAGGGGAGAGGATCG
ATTGGGGGGGAGGATCTTGACGATGAGGTTGATGACGAGGATGGCCACGACGACAGCCACATCGATCTTCATCTC
GATCTCCTACTCCCACACCCTCCGCCTCCGCCTCCGCCTCCGCCTCCCCCTACCCAACAAGACCGCCGCCCCTCC
ATCGTCCTAGCAAGCAACAGCCTCCTCCTCCCCCCGACCTCCGCCCCCCCTCAGCCAACGAGAAGTCAATTCCTC
CTCCTCAACAATAGCATCGTCAACAACAGCGACAGGGGTAGGGGCTGGAGGAACAAGGTCATCGGCATCAGCACC
AGCCCTCACGCCCCCCTCTGCCGTCCCGCTCAAGAGGCCTACGCGGTCGTCGGCCAGGGCGAGGATGCTGGAGGG
GAGGGAGAATGTGCCGCCTTTGGAGGTGGGGGAGGGGAGGAGGAAGAGTCCGAGGTTGAATTGACGGTTATGGCT
TCGTCTTGA
Gene >Ophcf2|02677
ATGTCCCTGTTCACGGCGCAGCTGCACCCCGGGCGAGCGCTCGGATTCTTGGGTAAGGAACAACGACGACTGCCA
GAGACGCGTGCTGACGCTTGACGCAGCGCTTGGGGCATCGTTGCACGACGTACTGACGCGGCTCAAGGCGGAGCC
ACAGCGGTTTCCGAAGCTCGAGGTGGTGTTTTCGTCCGAGAGACCGGTGACGGAGCCGGTGTGCGTGGTGCTGCC
CCATAACGGCATCCGACTGCGTTTCGACGGGTCTGAACAGCGACTACGACTCATCGAGGTGACCGATTTCACGAA
GAACCACATCACCTTCAAGGACCGAGACTTGCTAAAGCCTGCGGCTAACGGGGTGACAGCGACGGGCACACCGTC
GTCAACGGCGCTCGGCCCATCTTTTCGACACATCTACCACCGGGTTTTGGGGCCGACATACGCGGGCGAATTCAT
CCCGCCGAGGTCTGGGGGTGGAGATGGTATCTACGTGCTGTCGTATCCAGGCGTGGCCTTCAACTTCGCTCTGGC
AGAGGCGGCCTATTCGCCGGATAAGGACGTGGTTACGCTACTGGCGGCGGCATCCAGCCAGGCGGCCACGTCCAT
GGCCGTCTTCAGCGGCGACTCTTGGTCCGAAGCGCGGCCGAGCTTGTGGACGGGCCCGTTGCCGAACGTGAGGCT
GCCATCGTCGGTCGTCGCGAGCGGCGGCGGCGGAGTGCGGTCGCGAGACTCTTACCCGGACGAGGTGTCCCTGGT
CAAACTCCGCGGCGGCGGGCGCATCGACATGTTGCGCAAGTGGACGGGCTCAGGACCCGTCTTTCGGCTGCAGTT
GGGGGAGACGACGCCGCAGGATCTCGTCATGGCGCTGGGACCGCCGAGTGCCATCTACCGAAAGAACGATCAGAA
GATGGTTATCCACACGATGCGCGCTGCTCCTGTCGACGGCGCACGGGTGTCGGCGTCGGTAGCTGTCAAAACGGG
AGACGCCGAGCTGACGGATACGGATCAGTCATCGATGAACACGGCATCGGACGAGTCGGACGAAGCGGCAGCGGG
TGACGGCGTTAATGAAGACGGTGACGATCACGGCGGAGGGACTGGAGATGGAAGTCCCGCAGGCGAGTGCTTCTA
CAACTACTTTTACCTCGGCTTTGACGTTCTCCTCTCGACGCCCACGCCCGGGAAAGCCAACTTGGGCACAAGCAG
CGGCATCAAGAACCAGCATTCCGATCGGCTCGTAGCGAAAAAGCTGGTATTGCACGGCAACATCCCGGGCTGCTA
CGAGTTTAACCGGCACCGCCGATGCAGATGGGAGCTGCGCCCAGAAGGTGGAGGCGAAACCGACGATGACGCCAT
CGCGGACTCGGAGACGGAGTTCAAGACGATCGAGGAGCGTCTCGCGAGACACTGGGGCTCCGACGCAGCGCGGCA
CAGGGGTATGGTCCTCAACCGTGGCTGGGGCGACAGTCCGGGCAGTAGCTGCGAGTTTCTCGGCGGCTGGGAGGA
GAGCGGCGGTGGGAGGAGGGCCGAGGCCGGAGGAGGGGGGGACTCGACGACGACGCTGTACGGGTTTCCGGGGTT
GGTTTTTGAGGTGCTCCGGAATGGCTTCGTGAATACTGTGACGGTATTTTAGGCGCCACTTCGTGTGAGGGCTGG
TTTCGGCGTTTGAGCGAAGCCGGTGGTGAGGGCTGTTTGACGGTGGGTTGTTGGAGTTGGCAGCGAAGCTTACTA
AGACATGTTTATGTTTTGTCCCACCCAATCCCTGTCGCTACGGCTACGCGAGCCCTGCGCGCTCCTGCCTGCCAC
AGCTGTCCCTGTTTGTCTGCGTGATCACGGCTATTTTTCTCCTGCTCTTCTCCATCTCAGCCTCAGCTTCAGGCT
CGTCGCAAGATAGCAACCCAGTTTCGGTGTCTTGCGTCGCGGTCTCGGTTGCGACCGGCTTAGAAGACGACCAAC
TGATACCCGTCGTGGCAGTGGCTTCCCGGCGACAACAGACGCGTCCCGACCGCGAGGCGGCGGGTCGCCGCGCGG
TGCCGAGCATGAGGTCCGGAGCGACAGGCCGAGGCGGAGGGCGAACGGGCGTCATGCGGGCGCCTTCAACCGCTG
CCGTACGGCCATCGACATCATCGGCCGGCGCTGTCCGATCCGTGTCATCCTCGTCGGCCCGACAAGGCGGCGGGT
CACCGAGGGCGAAGCGCAAAGAACGCGAGTCATCGACGGAAGCGGGCGCTGCGATCGAGGGCAGTAACATTAATG
TCGTGGTCCGGTGCCGCGGACGCAGTGAGCGCGAGGTGCGCGAGGGGAGTCCCGTCGTGCTGAGGACGGATGGCG
TCAAGGGCAAGGTGGTGGAGCTGTCGACGGGGGCGCACGCGCTCAGCAACAAGACGTACAGCTTCGACCGGGTGT
TTTCTGCGGCGGCGGACCAGAACATGGTGTTTGACGACGTGGTCAAGCCGATACTGGACGACGTGAGCGTCTCTT
CCTCGTGGTTGTTGATGATGAAGCTGAAGCTGACTGGTCTTTACGTGTAGATGCTGGCCGGCTACAACTGCACCG
TCTTCGCATACGGGCAGACGGGCACGGGCAAGACGTACACCATGTCGGGCGACATGGAGGAGACGACGCCGGGCA
TGGTGTCGGAGGAGGCAGGCATCATCCCGCGAGCGCTACAGCACCTTTTCAACCGGCTGGAGCTGGGCGAGGCTG
AGAGCTGCGTCAAGTGCTCCTTTATCGAGCTGTACAACGAGGAGCTGCGCGATCTTCTGGCAGCCGAGGAGACGA
GGCTCAAGATGTTCGACGACGCGGCCCGCAAGACGACGGTGATTCAGGGCATGGAGGAGCGGCACATCGCCGACG
CGGCTCAAGGTCTTCGCGTGCTACGGCAGGGCAGCGTGAGGAGACAGGTGGCGGCCACCAAGTGCAACGACCTGA
GCTCGCGCGGCCACACAGTCTTCACCGTAACGGCCTACGTCAAGGGAGAGGGCGACGATGACGTCGTGGCCGCCG
GCAAGCTCAACCTGGTGGATCTGGCCGGGTCGGAGAATATCCAGCGGTCCGGGGCCGAGAAGCTGCGGGCGGCCG
AGGCCGGGCTCATCAACAAGTCGCTGCTCACGCTGGGGCGCGTCATCAACGCTCTGGTCGACGGCGGCGCTCACA
TCCCCTACCGCGAATCCAAGCTGACGCGGCTACTGCAAGACTCGCTGGGCGGACGGACCAAGACGTGCATCATCG
CGACGGTATCGCCGGCGAGAAGCAACCTCGAGGAGACCATGTCGACGCTCGACTACGCCTTTCGCGCAAAGAATA
TCCGCAACCGGCCGCAGCTCAACGCGCCGCTCAACAAGAAGATGCTGCTGCGCGACTTCGCCGCCGAGATTGAGC
GCCTCAAGGCTGATCTCATCGCGACGCGGCAGCGCAATGGAGTGTACCTGGCCATCGACGCCTACGATGACATGA
CGGCCCAGAGCGAGTCGCGTCGCATTGTCGTCGACGAGCAGGCGGCCAAGATCGAGACGCTCGAGTCGAACCTGC
GCAACAAGGTGCAGGATCTGTTCTCCATGACGTCGGCCTTTATGGGCCTTCGCCGCGATCACGACGCCACCAAGC
AGCAGCTGGACGAGACGCGCGGCCTGCTCGATCGTGCCGACATCGTCGTCGCAGCCACCAAGGCCTCGCTGGCCA
GGGAGACGCAGCGACGCCTGGCCCACGCCGAGACGGAGGAGCGTCTGGCGGCCATGGGCGGCGAGCTGGTCGACA
CGCTTCGCCGCACCGTCGGCGATGTCGACGGCCTTCACGCCAAGGTCCGCCGTCGCTCCGACCTGCACGCGCTGA
ACCGGTCCGCCTGGGCAGACGGACAGGCACATGTCGCCAGCATTACCGCCGCCGTGGAGCGCCGCCTGGACGACT
TTCGCCAAGCTCATCTGCGGCACGTGGCGTCCGTGGGCGATAGGCTCGATGGTCTGGTGGCCGATCAGCTGCGTG
GGTTGGACGCGACGCGCGCCCTGTTGGATGGTCATGTCGTTGCCCTGGATGAGTCGAGCCGGCTCGGGCGGGAGC
TGCGGCAGCGGGCCAGTGAGGATGAGGCCGCCTTGCTGGATGCCGTGGCCGATGTGCGCGACTCGCTCAAGATGC
ATCTGGCCGAGAGTCTGAAGGTTGTGTCTCGAGCAGCCGAGGCCATCTCTGCCGACGTGCTTCACGACATGACGA
CCTTTCACGCGACGGTCAGTTCCCCTCCCCCTTTATGTCCTTTCTTCTTCTTGTCTGACTATCCTCGATGATGTA
GCTCCACGACTCGTACAGCTCGCTCGGCAAGGACTTCAAATCCATCTTCGACGACCTCGTCCGCCACATGACAGC
CCAGCGAAGCGAGGCCGACGGTCTTCGGCGTCAGCTCCAGACCGCAGCCGCAGCCGCCGCGCTTCAAAATGCCTC
AGCAGCCGCGCGTATCCAGGAAGCGCTGGACGAGGAGAGACGCCAAGCAGCTGAGGAACGGCAGAAGCTCACGGC
ACAGGTCACAAGCCTGCTGGCTGCTCAAGGCGAGGCGCACGAAGCTCGCATGACGGAGCGGGCTTGCATGCTGCA
CCGCGCCGTAGCCGACTGCGGCGCCTCTCTCGAAGCGGCCGCATCACAGCACGGCCGCGGTATGGACGCATGGGA
CGAGCGCGAGGCCCGTCTGCTGGAAGAGGTGCGCCGATCTCGTGATCAGGTAAAGGCCAAGCTCAAGGACGACTG
GGCCGCGGCCGGCGAGCAGAGTGCGGCGATGCAGAAGACGGCCAGAGCGGTTCACGCCGAGACATCTCGCGTCGT
CGACGAGCAGGTCGATGGCCTAGATGCGCAGATGGAGCTTCTCGACCGGCTGGTAGCCCGCGCCCGGACGGAAAA
GACAACTCACGACTCGGAGCGTACGCAGGCAGCCCTCGTCCAAGCCCAGGCCGTCGAGCAGTCCGCCGCCATGGT
GGCGACGCAACTCCAGGCCGTGGCCGATGACGTCAGGGATTCGGGCGAGGAGATTGCGGCCGAGACGGAGCGGTT
GGCCGAAGAGGTCGAGCCGCTGGATGAGCTGGTCAGGAAGCCGCTCGAAGACCTGAGGTTCGGGCTCGGAGGGCT
GGCGTTGAAGGAGTATCAGCCGACGGGGAAGACGCCTCAGAAGGTGGTGTATACTTTTCCGACGGCGTTGCCTAG
GACCGAGGCCATTGAGGAGGATGAGGGTGAGGAGGATGAGGTGATGATGGAGGGGAGAGGATCGATTGGGGGGGA
GGATCTTGACGATGAGGTTGATGACGAGGATGGCCACGACGACAGCCACATCGATCTTCATCTCGATCTCCTACT
CCCACACCCTCCGCCTCCGCCTCCGCCTCCGCCTCCCCCTACCCAACAAGACCGCCGCCCCTCCATCGTCCTAGC
AAGCAACAGCCTCCTCCTCCCCCCGACCTCCGCCCCCCCTCAGCCAACGAGAAGTCAATTCCTCCTCCTCAACAA
TAGCATCGTCAACAACAGCGACAGGGGTAGGGGCTGGAGGAACAAGGTCATCGGCATCAGCACCAGCCCTCACGC
CCCCCTCTGCCGTCCCGCTCAAGAGGCCTACGCGGTCGTCGGCCAGGGCGAGGATGCTGGAGGGGAGGGAGAATG
TGCCGCCTTTGGAGGTGGGGGAGGGGAGGAGGAAGAGTCCGAGGTTGAATTGACGGTTGTACCCTGGTTTTTGAG
AGGATGGGGATGGAAAGGGGGTTGGTGCGTGTTGGTTGAGTTCCTAGATGGCTTCGTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail