Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02675
Gene name
Locationscaffold_02:4394167..4395898
Strand+
Gene length (bp)1731
Transcript length (bp)1674
Coding sequence length (bp)1674
Protein length (aa) 558

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14420 Clr5 Clr5 domain 2.9E-20 2 53

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4604 0.8187 0.0714 0.043 0.1242 0.021 0.0545 0.0813 0.0616 0.0265

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6058
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|02675 (this protein)
Ophiocordyceps kimflemingae Ophio5|4885
Ophiocordyceps subramaniannii Hirsu2|2205
Ophiocordyceps subramaniannii Hirsu2|5890

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02675
MVYDWERHRQTCRTLYIEEGRSLEYIMTYMKATHHFAPSKRAFQLQFRRWDFPRKQRPAHKNSRLVSRVRELWAS
NHGQRDMLRILNDEDGFEIKARELSRLRIRNGWLVRAPNGDKAVEEDEDDNPSGHDFVPAEQPAVADPVLNGSRH
RARRKDGCAAVRFPSETTLNDARRMLNLDDASYRALRAQFQCICHEMALISKTMAGADAWEAAKARLACQIPRLR
TVDDERERLALDIICTDVTKRLRSLGRRMSQAEAKKKLGIDPDQSRRMHVEFRQLLAQSALTCKSDASPQLWEEL
KRIWAERSGLVQPMWSDAGGETNGDWKRALEVLAGDVVKRVRDERGRSVNRKQRRQTQRQPQQQQRQKDGDTPIS
FNGHAFDEAAHAYLNSVDTMETLSLESALLLVETPSDEDTSLFEQADVGEFEPSMDDGHCDQSMTSSCESEPRPA
RAAFMRLQPGSGYVPSSAGRGPSSNRLWVAALSGHSMEELRAAAEAKFPGSVCVGVVEGVLRDGRGHEMEPLRIE
RDQELGAYLTHLEGMTPTFGVRLEWKALHGGI*
Coding >Ophcf2|02675
ATGGTGTACGATTGGGAACGCCACCGACAGACATGTCGCACGCTCTACATCGAAGAGGGCCGGTCCCTCGAGTAT
ATAATGACCTATATGAAGGCAACCCACCACTTCGCCCCGAGCAAGCGAGCCTTTCAGCTACAGTTCCGCCGATGG
GACTTTCCGCGTAAGCAACGTCCGGCTCACAAGAACAGTCGGCTGGTTTCGCGCGTCCGCGAGCTGTGGGCTAGC
AACCATGGCCAGCGGGACATGTTGCGTATCCTCAACGACGAGGACGGGTTCGAGATCAAGGCGAGGGAGTTGTCA
CGCTTGAGAATTCGAAACGGCTGGCTGGTGAGGGCTCCCAACGGGGATAAGGCTGTTGAAGAGGACGAGGACGAC
AACCCGAGCGGACACGACTTCGTGCCGGCGGAGCAACCCGCCGTGGCCGATCCCGTACTCAACGGCTCGAGACAT
CGAGCCCGGCGGAAAGATGGTTGTGCCGCCGTGCGGTTCCCGTCCGAGACGACGCTCAATGATGCGCGCCGCATG
CTGAACCTCGACGACGCCTCTTACCGCGCCTTGCGAGCACAATTCCAATGCATATGTCATGAGATGGCCCTCATC
AGCAAGACCATGGCCGGTGCTGATGCGTGGGAAGCGGCAAAGGCGCGGCTCGCCTGTCAAATCCCTCGGCTCCGG
ACGGTCGACGATGAGCGCGAAAGGTTGGCACTCGACATCATCTGCACCGACGTGACGAAGCGGCTGCGAAGCTTG
GGAAGACGCATGTCACAGGCGGAGGCGAAGAAGAAACTCGGCATCGATCCCGATCAGTCGCGGCGCATGCATGTC
GAGTTTCGTCAGCTGCTCGCCCAGTCGGCGCTCACGTGCAAGTCGGACGCCAGTCCGCAGCTATGGGAGGAGTTG
AAGCGCATCTGGGCTGAGAGATCGGGTCTCGTGCAGCCAATGTGGAGTGATGCGGGAGGGGAGACGAACGGCGAT
TGGAAGAGGGCCCTCGAGGTGTTGGCTGGAGATGTCGTGAAGCGCGTGCGTGATGAGAGGGGGCGGAGTGTGAAT
CGGAAGCAGAGGCGGCAGACACAGCGGCAGCCACAGCAGCAGCAGCGGCAGAAAGACGGCGACACGCCCATCTCG
TTCAATGGCCACGCCTTTGATGAAGCGGCGCATGCTTATCTGAACTCCGTCGATACCATGGAGACGCTATCCCTG
GAGTCCGCCTTATTGCTGGTCGAGACGCCGTCGGACGAGGACACGAGCTTGTTTGAGCAAGCAGACGTTGGAGAA
TTCGAGCCTTCGATGGACGACGGGCATTGTGACCAGTCAATGACCTCGTCCTGCGAATCGGAGCCGAGACCGGCG
CGGGCCGCCTTCATGCGACTGCAGCCGGGGTCGGGCTACGTGCCGTCGTCGGCCGGCAGAGGCCCCAGCAGCAAC
AGACTCTGGGTAGCTGCGTTGAGCGGGCATTCGATGGAGGAGCTGCGGGCGGCGGCGGAGGCCAAGTTCCCAGGC
AGCGTCTGCGTGGGCGTCGTCGAGGGCGTGCTGAGAGATGGCAGGGGGCATGAGATGGAGCCGCTGCGCATCGAG
CGCGATCAGGAACTGGGCGCATATCTGACACACCTGGAGGGCATGACTCCGACGTTTGGCGTTCGGCTGGAGTGG
AAGGCGCTGCATGGGGGGATTTGA
Transcript >Ophcf2|02675
ATGGTGTACGATTGGGAACGCCACCGACAGACATGTCGCACGCTCTACATCGAAGAGGGCCGGTCCCTCGAGTAT
ATAATGACCTATATGAAGGCAACCCACCACTTCGCCCCGAGCAAGCGAGCCTTTCAGCTACAGTTCCGCCGATGG
GACTTTCCGCGTAAGCAACGTCCGGCTCACAAGAACAGTCGGCTGGTTTCGCGCGTCCGCGAGCTGTGGGCTAGC
AACCATGGCCAGCGGGACATGTTGCGTATCCTCAACGACGAGGACGGGTTCGAGATCAAGGCGAGGGAGTTGTCA
CGCTTGAGAATTCGAAACGGCTGGCTGGTGAGGGCTCCCAACGGGGATAAGGCTGTTGAAGAGGACGAGGACGAC
AACCCGAGCGGACACGACTTCGTGCCGGCGGAGCAACCCGCCGTGGCCGATCCCGTACTCAACGGCTCGAGACAT
CGAGCCCGGCGGAAAGATGGTTGTGCCGCCGTGCGGTTCCCGTCCGAGACGACGCTCAATGATGCGCGCCGCATG
CTGAACCTCGACGACGCCTCTTACCGCGCCTTGCGAGCACAATTCCAATGCATATGTCATGAGATGGCCCTCATC
AGCAAGACCATGGCCGGTGCTGATGCGTGGGAAGCGGCAAAGGCGCGGCTCGCCTGTCAAATCCCTCGGCTCCGG
ACGGTCGACGATGAGCGCGAAAGGTTGGCACTCGACATCATCTGCACCGACGTGACGAAGCGGCTGCGAAGCTTG
GGAAGACGCATGTCACAGGCGGAGGCGAAGAAGAAACTCGGCATCGATCCCGATCAGTCGCGGCGCATGCATGTC
GAGTTTCGTCAGCTGCTCGCCCAGTCGGCGCTCACGTGCAAGTCGGACGCCAGTCCGCAGCTATGGGAGGAGTTG
AAGCGCATCTGGGCTGAGAGATCGGGTCTCGTGCAGCCAATGTGGAGTGATGCGGGAGGGGAGACGAACGGCGAT
TGGAAGAGGGCCCTCGAGGTGTTGGCTGGAGATGTCGTGAAGCGCGTGCGTGATGAGAGGGGGCGGAGTGTGAAT
CGGAAGCAGAGGCGGCAGACACAGCGGCAGCCACAGCAGCAGCAGCGGCAGAAAGACGGCGACACGCCCATCTCG
TTCAATGGCCACGCCTTTGATGAAGCGGCGCATGCTTATCTGAACTCCGTCGATACCATGGAGACGCTATCCCTG
GAGTCCGCCTTATTGCTGGTCGAGACGCCGTCGGACGAGGACACGAGCTTGTTTGAGCAAGCAGACGTTGGAGAA
TTCGAGCCTTCGATGGACGACGGGCATTGTGACCAGTCAATGACCTCGTCCTGCGAATCGGAGCCGAGACCGGCG
CGGGCCGCCTTCATGCGACTGCAGCCGGGGTCGGGCTACGTGCCGTCGTCGGCCGGCAGAGGCCCCAGCAGCAAC
AGACTCTGGGTAGCTGCGTTGAGCGGGCATTCGATGGAGGAGCTGCGGGCGGCGGCGGAGGCCAAGTTCCCAGGC
AGCGTCTGCGTGGGCGTCGTCGAGGGCGTGCTGAGAGATGGCAGGGGGCATGAGATGGAGCCGCTGCGCATCGAG
CGCGATCAGGAACTGGGCGCATATCTGACACACCTGGAGGGCATGACTCCGACGTTTGGCGTTCGGCTGGAGTGG
AAGGCGCTGCATGGGGGGATTTGA
Gene >Ophcf2|02675
ATGGTGTACGATTGGGAACGCCACCGACAGACATGTCGCACGCTCTACATCGAAGAGGGCCGGTCCCTCGAGTAT
ATAATGACCTATATGAAGGCAACCCACCACTTCGCCCCGAGGTGAGCGAGCCAGTCTCCCGTTCAGAGGATTGGA
ACGTCTGACACGCATCGCAACAGCAAGCGAGCCTTTCAGCTACAGTTCCGCCGATGGGACTTTCCGCGTAAGCAA
CGTCCGGCTCACAAGAACAGTCGGCTGGTTTCGCGCGTCCGCGAGCTGTGGGCTAGCAACCATGGCCAGCGGGAC
ATGTTGCGTATCCTCAACGACGAGGACGGGTTCGAGATCAAGGCGAGGGAGTTGTCACGCTTGAGAATTCGAAAC
GGCTGGCTGGTGAGGGCTCCCAACGGGGATAAGGCTGTTGAAGAGGACGAGGACGACAACCCGAGCGGACACGAC
TTCGTGCCGGCGGAGCAACCCGCCGTGGCCGATCCCGTACTCAACGGCTCGAGACATCGAGCCCGGCGGAAAGAT
GGTTGTGCCGCCGTGCGGTTCCCGTCCGAGACGACGCTCAATGATGCGCGCCGCATGCTGAACCTCGACGACGCC
TCTTACCGCGCCTTGCGAGCACAATTCCAATGCATATGTCATGAGATGGCCCTCATCAGCAAGACCATGGCCGGT
GCTGATGCGTGGGAAGCGGCAAAGGCGCGGCTCGCCTGTCAAATCCCTCGGCTCCGGACGGTCGACGATGAGCGC
GAAAGGTTGGCACTCGACATCATCTGCACCGACGTGACGAAGCGGCTGCGAAGCTTGGGAAGACGCATGTCACAG
GCGGAGGCGAAGAAGAAACTCGGCATCGATCCCGATCAGTCGCGGCGCATGCATGTCGAGTTTCGTCAGCTGCTC
GCCCAGTCGGCGCTCACGTGCAAGTCGGACGCCAGTCCGCAGCTATGGGAGGAGTTGAAGCGCATCTGGGCTGAG
AGATCGGGTCTCGTGCAGCCAATGTGGAGTGATGCGGGAGGGGAGACGAACGGCGATTGGAAGAGGGCCCTCGAG
GTGTTGGCTGGAGATGTCGTGAAGCGCGTGCGTGATGAGAGGGGGCGGAGTGTGAATCGGAAGCAGAGGCGGCAG
ACACAGCGGCAGCCACAGCAGCAGCAGCGGCAGAAAGACGGCGACACGCCCATCTCGTTCAATGGCCACGCCTTT
GATGAAGCGGCGCATGCTTATCTGAACTCCGTCGATACCATGGAGACGCTATCCCTGGAGTCCGCCTTATTGCTG
GTCGAGACGCCGTCGGACGAGGACACGAGCTTGTTTGAGCAAGCAGACGTTGGAGAATTCGAGCCTTCGATGGAC
GACGGGCATTGTGACCAGTCAATGACCTCGTCCTGCGAATCGGAGCCGAGACCGGCGCGGGCCGCCTTCATGCGA
CTGCAGCCGGGGTCGGGCTACGTGCCGTCGTCGGCCGGCAGAGGCCCCAGCAGCAACAGACTCTGGGTAGCTGCG
TTGAGCGGGCATTCGATGGAGGAGCTGCGGGCGGCGGCGGAGGCCAAGTTCCCAGGCAGCGTCTGCGTGGGCGTC
GTCGAGGGCGTGCTGAGAGATGGCAGGGGGCATGAGATGGAGCCGCTGCGCATCGAGCGCGATCAGGAACTGGGC
GCATATCTGACACACCTGGAGGGCATGACTCCGACGTTTGGCGTTCGGCTGGAGTGGAAGGCGCTGCATGGGGGG
ATTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail