Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02670
Gene name
Locationscaffold_02:4382119..4384199
Strand+
Gene length (bp)2080
Transcript length (bp)1791
Coding sequence length (bp)1791
Protein length (aa) 597

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00494 SQS_PSY Squalene/phytoene synthase 3.4E-50 286 569

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 36 55 19
3 75 97 22
4 117 136 19
5 146 168 22
6 173 192 19
7 218 240 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02670
MGFDYWLVHLTWTVPPALLTTALYWPFFSKLEMAKVSALVSMAVVCTLPWDSFLVRNRIWSYPTDAVVGISFFSV
PIEEIFFFVIQTYNTGILYVILTKQLVLPVYLGNRTSARRRLAGFLGLGSVFLLALLGVVSRGRHTYMSLILAWV
TPFLMLQWAVCSHFLLALPRARLLLTVLLPSLYLCIVDALALRRGTWVIEDGTKMGYEVLGLLEIEEAVFFFVTN
LMIVMGLVTVDYHIAMEEYQMARSPSPGKRFPSLTRLLRGCKEPDADFIRGLADAVDVVSSKSQTMYMGSAMFEA
ALRIDLILLYNFCRVLDDVVDEADDLEAARSAVQTCRQALRVRFQQSTEKTTDDYHFVCASPALSSAIALLPVSR
LSIEPLDSLLLGFETDFDFSQAASGYGDDWPIATERDLETYAYRVAGTVAASLLSLVLYHYPLDDDDGQQRQGTT
GDDNDDDARRGIVTAGARMGQALQYVNIARDVGRDAAIGRVYLPQTWLRQEGLDAASVVARPRDGPMAKLQGRML
DKAHRAYRATEAVMDELPVEVRGPIRTVVEGYMAIAGSVLADGLRGKGKLKLPWWRRLIVARRAMGRAKGV*
Coding >Ophcf2|02670
ATGGGGTTCGACTACTGGCTTGTCCATTTGACATGGACCGTCCCGCCGGCCTTGTTGACGACGGCCCTTTATTGG
CCCTTTTTCTCCAAGTTGGAGATGGCCAAGGTATCGGCTTTGGTGTCGATGGCCGTCGTCTGCACCCTGCCGTGG
GACTCGTTCCTAGTCCGTAACCGCATCTGGTCGTATCCAACGGACGCCGTCGTCGGCATCAGCTTCTTCTCCGTT
CCCATTGAAGAGATCTTCTTCTTCGTCATCCAGACCTACAACACTGGGATCTTGTACGTCATCTTAACCAAGCAG
CTGGTGCTTCCCGTCTATCTCGGCAACCGGACCAGTGCACGCCGACGCCTGGCCGGTTTTCTGGGCCTCGGGAGT
GTCTTTCTGCTCGCTCTTCTTGGAGTCGTCTCCAGAGGCAGACACACATACATGAGCCTCATCCTGGCATGGGTT
ACCCCCTTTTTGATGCTCCAGTGGGCTGTGTGCTCTCACTTCTTGCTGGCGCTGCCTCGGGCCAGATTGCTGCTC
ACTGTCCTGTTGCCTTCACTCTATTTGTGCATAGTGGACGCTTTGGCCCTGCGGCGCGGCACCTGGGTGATCGAG
GACGGCACCAAGATGGGCTACGAGGTTCTAGGCTTGCTCGAGATAGAGGAGGCGGTCTTCTTCTTTGTCACCAAC
CTCATGATCGTCATGGGCCTCGTCACCGTCGACTATCACATCGCCATGGAAGAGTATCAGATGGCTAGATCACCC
AGTCCGGGAAAGCGATTTCCGTCATTGACTAGGCTTCTGCGCGGCTGCAAGGAGCCTGACGCGGACTTTATTCGA
GGCTTGGCCGATGCCGTCGACGTCGTCTCCAGCAAGAGTCAGACCATGTACATGGGCAGTGCCATGTTTGAGGCG
GCCCTGCGGATCGATCTAATCTTGCTATATAATTTCTGCCGTGTTCTCGACGACGTCGTCGATGAAGCTGACGAT
TTGGAGGCCGCACGGAGCGCCGTTCAGACCTGCCGTCAAGCTCTGCGGGTCCGCTTCCAGCAGTCGACTGAAAAG
ACGACGGACGACTACCACTTCGTATGCGCATCTCCGGCCCTGAGCTCTGCCATTGCGCTACTGCCGGTGTCACGG
CTGTCGATAGAGCCGCTCGACAGCCTCCTGTTGGGTTTCGAGACGGACTTCGACTTCTCGCAGGCTGCTTCGGGC
TATGGAGACGACTGGCCGATCGCCACGGAGAGGGATCTCGAGACGTACGCATATCGTGTGGCTGGCACGGTGGCG
GCGTCGCTGCTCAGCTTGGTGCTGTATCACTACCCGCTCGACGACGATGATGGCCAGCAGCGACAGGGGACGACC
GGCGATGATAATGATGATGACGCCAGGAGGGGGATCGTGACGGCCGGCGCCAGGATGGGCCAAGCTCTTCAGTAC
GTCAATATCGCGCGCGACGTGGGCCGCGACGCAGCCATCGGGCGCGTCTATCTGCCGCAGACATGGCTACGACAG
GAAGGCCTGGACGCAGCCTCGGTGGTGGCGAGGCCGCGGGACGGACCGATGGCGAAGCTCCAGGGCCGGATGCTC
GACAAGGCTCACCGGGCGTACCGGGCCACCGAGGCTGTCATGGACGAGCTCCCCGTGGAGGTCCGGGGCCCGATC
CGTACCGTGGTTGAGGGCTACATGGCCATTGCGGGCTCTGTCCTGGCCGACGGACTGCGAGGGAAGGGGAAGCTG
AAGCTGCCGTGGTGGCGCCGCCTGATTGTTGCTAGGAGAGCGATGGGCAGGGCAAAAGGGGTGTAG
Transcript >Ophcf2|02670
ATGGGGTTCGACTACTGGCTTGTCCATTTGACATGGACCGTCCCGCCGGCCTTGTTGACGACGGCCCTTTATTGG
CCCTTTTTCTCCAAGTTGGAGATGGCCAAGGTATCGGCTTTGGTGTCGATGGCCGTCGTCTGCACCCTGCCGTGG
GACTCGTTCCTAGTCCGTAACCGCATCTGGTCGTATCCAACGGACGCCGTCGTCGGCATCAGCTTCTTCTCCGTT
CCCATTGAAGAGATCTTCTTCTTCGTCATCCAGACCTACAACACTGGGATCTTGTACGTCATCTTAACCAAGCAG
CTGGTGCTTCCCGTCTATCTCGGCAACCGGACCAGTGCACGCCGACGCCTGGCCGGTTTTCTGGGCCTCGGGAGT
GTCTTTCTGCTCGCTCTTCTTGGAGTCGTCTCCAGAGGCAGACACACATACATGAGCCTCATCCTGGCATGGGTT
ACCCCCTTTTTGATGCTCCAGTGGGCTGTGTGCTCTCACTTCTTGCTGGCGCTGCCTCGGGCCAGATTGCTGCTC
ACTGTCCTGTTGCCTTCACTCTATTTGTGCATAGTGGACGCTTTGGCCCTGCGGCGCGGCACCTGGGTGATCGAG
GACGGCACCAAGATGGGCTACGAGGTTCTAGGCTTGCTCGAGATAGAGGAGGCGGTCTTCTTCTTTGTCACCAAC
CTCATGATCGTCATGGGCCTCGTCACCGTCGACTATCACATCGCCATGGAAGAGTATCAGATGGCTAGATCACCC
AGTCCGGGAAAGCGATTTCCGTCATTGACTAGGCTTCTGCGCGGCTGCAAGGAGCCTGACGCGGACTTTATTCGA
GGCTTGGCCGATGCCGTCGACGTCGTCTCCAGCAAGAGTCAGACCATGTACATGGGCAGTGCCATGTTTGAGGCG
GCCCTGCGGATCGATCTAATCTTGCTATATAATTTCTGCCGTGTTCTCGACGACGTCGTCGATGAAGCTGACGAT
TTGGAGGCCGCACGGAGCGCCGTTCAGACCTGCCGTCAAGCTCTGCGGGTCCGCTTCCAGCAGTCGACTGAAAAG
ACGACGGACGACTACCACTTCGTATGCGCATCTCCGGCCCTGAGCTCTGCCATTGCGCTACTGCCGGTGTCACGG
CTGTCGATAGAGCCGCTCGACAGCCTCCTGTTGGGTTTCGAGACGGACTTCGACTTCTCGCAGGCTGCTTCGGGC
TATGGAGACGACTGGCCGATCGCCACGGAGAGGGATCTCGAGACGTACGCATATCGTGTGGCTGGCACGGTGGCG
GCGTCGCTGCTCAGCTTGGTGCTGTATCACTACCCGCTCGACGACGATGATGGCCAGCAGCGACAGGGGACGACC
GGCGATGATAATGATGATGACGCCAGGAGGGGGATCGTGACGGCCGGCGCCAGGATGGGCCAAGCTCTTCAGTAC
GTCAATATCGCGCGCGACGTGGGCCGCGACGCAGCCATCGGGCGCGTCTATCTGCCGCAGACATGGCTACGACAG
GAAGGCCTGGACGCAGCCTCGGTGGTGGCGAGGCCGCGGGACGGACCGATGGCGAAGCTCCAGGGCCGGATGCTC
GACAAGGCTCACCGGGCGTACCGGGCCACCGAGGCTGTCATGGACGAGCTCCCCGTGGAGGTCCGGGGCCCGATC
CGTACCGTGGTTGAGGGCTACATGGCCATTGCGGGCTCTGTCCTGGCCGACGGACTGCGAGGGAAGGGGAAGCTG
AAGCTGCCGTGGTGGCGCCGCCTGATTGTTGCTAGGAGAGCGATGGGCAGGGCAAAAGGGGTGTAG
Gene >Ophcf2|02670
ATGGGGTTCGACTACTGGCTTGTGTGCGTTGTCCTCGTGGTGCTTCGTGGAAGTGTTGGTTCTCATACGTACTTC
TCAGCCATTTGACATGGACCGTCCCGCCGGCCTTGTTGACGACGGCCCTTTATTGGCCCTTTTTCTCCAAGTTGG
AGATGGCCAAGGTATCGGCTTTGGTGTCGGTACGCAATGAGCCCAACTCTCTCGGATGCCTCGTCAACTCATATC
CGGTGACAGATGGCCGTCGTCTGCACCCTGCCGTGGGACTCGTTCCTAGTCCGTAACCGCATCTGGTCGTATCCA
ACGGACGCCGTCGTCGGCATCAGCTTCTTCTCCGTTCCCATTGAAGAGATCTTCTTCTTCGTCATCCAGACCTAC
AACACTGGGATCTTGTACGTCATCTTAACCAAGCAGCTGGTGCTTCCCGTCTATCTCGGCAACCGGACCAGTGCA
CGCCGACGCCTGGCCGGTTTTCTGGGCCTCGGGAGTGTCTTTCTGCTCGCTCTTCTTGGAGTCGTCTCCAGAGGC
AGACACACATACATGAGCCTCATCCTGGCATGGGTTACCCCCTTTTTGATGCTCCAGTGGTGAGTCTCGATATTA
TGCAACAAGTTTGAGAGGATAGACGCGGGAGATGTTAATACAAATATCAGGGCTGTGTGCTCTCACTTCTTGCTG
GCGCTGCCTCGGGCCAGATTGCTGCTCACTGTCCTGTTGCCTTCACTCTATTTGTGCATAGTGGACGCTTTGGCC
CTGCGGCGCGGCACCTGGGTGATCGAGGACGGCACCAAGATGGGCTACGAGGTTCTAGGCTTGCTCGAGATAGAG
TATGTTGTCTACGCTTCTCCCGTATGACGCTACGAAAACCAACACGGTTTCTCTCACAGGGAGGCGGTCTTCTTC
TTTGTCACCAACCTCATGATCGTCATGGGCCTCGTCACCGTCGACTATCACATCGCCATGGAAGAGTATCAGATG
GCTAGATCACCCAGTCCGGGAAAGCGATTTCCGTCATTGACTAGGCTTCTGCGCGGCTGCAAGGAGCCTGACGCG
GACTTTATTCGAGGCTTGGCCGATGCCGTCGACGTCGTCTCCAGCAAGAGTCAGACCATGTACATGGGCAGTGCC
ATGTTTGAGGCGGCCCTGCGGATCGATCTAATCTTGCTGTGAGTGATTAGTCAAGTATATACCTAAGCACAAGGG
TTGACGATCCGTGAGATATAATTTCTGCCGTGTTCTCGACGACGTCGTCGATGAAGCTGACGATTTGGAGGCCGC
ACGGAGCGCCGTTCAGACCTGCCGTCAAGCTCTGCGGGTCCGCTTCCAGCAGTCGACTGAAAAGACGACGGACGA
CTACCACTTCGTATGCGCATCTCCGGCCCTGAGCTCTGCCATTGCGCTACTGCCGGTGTCACGGCTGTCGATAGA
GCCGCTCGACAGCCTCCTGTTGGGTTTCGAGACGGACTTCGACTTCTCGCAGGCTGCTTCGGGCTATGGAGACGA
CTGGCCGATCGCCACGGAGAGGGATCTCGAGACGTACGCATATCGTGTGGCTGGCACGGTGGCGGCGTCGCTGCT
CAGCTTGGTGCTGTATCACTACCCGCTCGACGACGATGATGGCCAGCAGCGACAGGGGACGACCGGCGATGATAA
TGATGATGACGCCAGGAGGGGGATCGTGACGGCCGGCGCCAGGATGGGCCAAGCTCTTCAGTACGTCAATATCGC
GCGCGACGTGGGCCGCGACGCAGCCATCGGGCGCGTCTATCTGCCGCAGACATGGCTACGACAGGAAGGCCTGGA
CGCAGCCTCGGTGGTGGCGAGGCCGCGGGACGGACCGATGGCGAAGCTCCAGGGCCGGATGCTCGACAAGGCTCA
CCGGGCGTACCGGGCCACCGAGGCTGTCATGGACGAGCTCCCCGTGGAGGTCCGGGGCCCGATCCGTACCGTGGT
TGAGGGCTACATGGCCATTGCGGGCTCTGTCCTGGCCGACGGACTGCGAGGGAAGGGGAAGCTGAAGCTGCCGTG
GTGGCGCCGCCTGATTGTTGCTAGGAGAGCGATGGGCAGGGCAAAAGGGGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail