Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02668
Gene name
Locationscaffold_02:4378448..4380197
Strand+
Gene length (bp)1749
Transcript length (bp)1515
Coding sequence length (bp)1515
Protein length (aa) 505

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 7.1E-91 17 414

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 46 68 22
3 95 117 22
4 137 159 22
5 166 188 22
6 208 230 22
7 243 265 22
8 275 297 22
9 354 373 19
10 378 400 22
11 481 503 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02668
MARTRRRGGKDGGHGGQATTPSSIVNLLNTIIGAGTLAMPSVLSHMGIMLGVVLILWSGITAAFGLYLQSRCARY
LDRGTSSFFALSQITYPNASVIFDLAIAVKCFGVAISYMIIIGDLMPGVMLGFNDAVADIPYLVDRHFWITAFML
LIIPLSFLRRLDSLKYTSLIGLVSIGYLIVLVIYHFAADAHADPRDIRVIQWAGPVETLSALPVVVFAYTCHQNM
FSIINEIKDNSPASMVEVVASSIGSAACIYVLVAITGYITFGNFIVGNIISMYPTGVASTIGKAAIVLLVLFSIP
LQIHPCRASLHAVLKWRPNRSGANAGRPGSPLFNASAVPRGDHGSSTPISDTRFAILTTAILTLAYMTALSVSSL
DRVLAFVGSTGSTSISFILPGLFYYKISDPESIHHQRLIKGDDDMDDEPSSDVEEIAGGMLAQSTSSIRGGTGAV
TGSQPRWRWRRKWRWDLEHLDHQLTRKLALSLAAYGIVVMTVCLLMNIFFAVAH*
Coding >Ophcf2|02668
ATGGCGAGGACCCGAAGACGAGGCGGCAAGGATGGCGGCCACGGCGGTCAGGCTACGACGCCCAGCAGCATCGTC
AACCTGCTGAATACGATCATTGGCGCTGGCACTCTGGCTATGCCCTCTGTTCTGTCTCATATGGGCATCATGCTC
GGCGTCGTCCTCATACTCTGGTCGGGCATCACGGCCGCCTTTGGCCTCTACCTGCAGTCACGCTGCGCCCGCTAT
CTCGACCGCGGCACGTCGTCCTTTTTCGCCCTATCGCAAATCACATATCCCAATGCCTCGGTCATCTTCGATCTG
GCAATCGCCGTCAAGTGCTTTGGTGTCGCCATCTCCTACATGATCATCATTGGCGATCTCATGCCCGGCGTCATG
CTCGGCTTCAACGACGCCGTCGCCGACATTCCATATCTAGTCGACAGACATTTCTGGATCACGGCCTTTATGCTC
CTCATCATTCCGCTGAGCTTCTTGCGCAGGCTCGACTCGCTCAAGTATACCAGCCTCATCGGCCTGGTCTCCATC
GGCTATCTCATTGTCCTCGTCATTTACCACTTCGCCGCCGACGCCCACGCTGACCCGCGCGATATTCGAGTTATC
CAATGGGCTGGGCCGGTCGAAACGCTGAGCGCGCTTCCCGTCGTCGTCTTCGCCTATACGTGCCATCAGAATATG
TTCTCCATAATCAACGAGATCAAAGACAACTCTCCCGCGAGCATGGTCGAGGTGGTGGCTTCGAGCATCGGTTCC
GCCGCGTGCATCTACGTTCTCGTAGCCATTACGGGCTACATTACGTTTGGAAACTTCATCGTCGGCAACATCATC
TCCATGTATCCCACCGGCGTCGCATCTACCATTGGCAAGGCCGCCATTGTCCTCCTCGTCCTCTTCTCCATTCCG
CTGCAGATTCACCCCTGCCGCGCCTCTCTGCACGCCGTCCTCAAGTGGCGTCCCAACCGGTCAGGCGCCAATGCC
GGCCGGCCAGGCTCTCCGCTGTTCAATGCGTCGGCCGTGCCGCGCGGCGACCACGGCAGCAGCACGCCCATCTCG
GACACGCGATTTGCCATCCTTACCACGGCCATCCTGACGCTAGCCTACATGACGGCGCTGTCTGTCAGCAGCCTG
GACCGCGTCCTCGCTTTCGTCGGCAGCACGGGCTCGACATCCATCAGCTTCATCCTCCCGGGCCTGTTCTACTAC
AAGATTAGCGACCCGGAGAGCATCCACCACCAGCGTCTGATCAAGGGAGACGACGACATGGACGACGAGCCCTCG
TCAGACGTCGAGGAGATCGCCGGCGGAATGCTGGCACAGAGCACGTCTAGCATACGAGGTGGTACCGGCGCCGTC
ACCGGCTCGCAGCCGCGCTGGCGATGGCGACGGAAATGGAGATGGGATCTGGAACACCTCGATCACCAGTTGACG
AGGAAGCTAGCGCTCTCGCTAGCAGCCTACGGCATCGTCGTCATGACCGTCTGCCTGCTAATGAACATATTCTTT
GCGGTCGCTCATTAG
Transcript >Ophcf2|02668
ATGGCGAGGACCCGAAGACGAGGCGGCAAGGATGGCGGCCACGGCGGTCAGGCTACGACGCCCAGCAGCATCGTC
AACCTGCTGAATACGATCATTGGCGCTGGCACTCTGGCTATGCCCTCTGTTCTGTCTCATATGGGCATCATGCTC
GGCGTCGTCCTCATACTCTGGTCGGGCATCACGGCCGCCTTTGGCCTCTACCTGCAGTCACGCTGCGCCCGCTAT
CTCGACCGCGGCACGTCGTCCTTTTTCGCCCTATCGCAAATCACATATCCCAATGCCTCGGTCATCTTCGATCTG
GCAATCGCCGTCAAGTGCTTTGGTGTCGCCATCTCCTACATGATCATCATTGGCGATCTCATGCCCGGCGTCATG
CTCGGCTTCAACGACGCCGTCGCCGACATTCCATATCTAGTCGACAGACATTTCTGGATCACGGCCTTTATGCTC
CTCATCATTCCGCTGAGCTTCTTGCGCAGGCTCGACTCGCTCAAGTATACCAGCCTCATCGGCCTGGTCTCCATC
GGCTATCTCATTGTCCTCGTCATTTACCACTTCGCCGCCGACGCCCACGCTGACCCGCGCGATATTCGAGTTATC
CAATGGGCTGGGCCGGTCGAAACGCTGAGCGCGCTTCCCGTCGTCGTCTTCGCCTATACGTGCCATCAGAATATG
TTCTCCATAATCAACGAGATCAAAGACAACTCTCCCGCGAGCATGGTCGAGGTGGTGGCTTCGAGCATCGGTTCC
GCCGCGTGCATCTACGTTCTCGTAGCCATTACGGGCTACATTACGTTTGGAAACTTCATCGTCGGCAACATCATC
TCCATGTATCCCACCGGCGTCGCATCTACCATTGGCAAGGCCGCCATTGTCCTCCTCGTCCTCTTCTCCATTCCG
CTGCAGATTCACCCCTGCCGCGCCTCTCTGCACGCCGTCCTCAAGTGGCGTCCCAACCGGTCAGGCGCCAATGCC
GGCCGGCCAGGCTCTCCGCTGTTCAATGCGTCGGCCGTGCCGCGCGGCGACCACGGCAGCAGCACGCCCATCTCG
GACACGCGATTTGCCATCCTTACCACGGCCATCCTGACGCTAGCCTACATGACGGCGCTGTCTGTCAGCAGCCTG
GACCGCGTCCTCGCTTTCGTCGGCAGCACGGGCTCGACATCCATCAGCTTCATCCTCCCGGGCCTGTTCTACTAC
AAGATTAGCGACCCGGAGAGCATCCACCACCAGCGTCTGATCAAGGGAGACGACGACATGGACGACGAGCCCTCG
TCAGACGTCGAGGAGATCGCCGGCGGAATGCTGGCACAGAGCACGTCTAGCATACGAGGTGGTACCGGCGCCGTC
ACCGGCTCGCAGCCGCGCTGGCGATGGCGACGGAAATGGAGATGGGATCTGGAACACCTCGATCACCAGTTGACG
AGGAAGCTAGCGCTCTCGCTAGCAGCCTACGGCATCGTCGTCATGACCGTCTGCCTGCTAATGAACATATTCTTT
GCGGTCGCTCATTAG
Gene >Ophcf2|02668
ATGGCGAGGTGCGTCGCTGGCACTGCATCTCGAGGGGCCGAGCGATGGGCGCTGACCTACTCAAAGGACCCGAAG
ACGAGGCGGCAAGGATGGCGGCCACGGCGGTCAGGCTACGACGCCCAGCAGCATCGTCAACCTGCTGAATACGAG
TTCGCGCCCATCCCCTCTCCGACTGAGCTAGCTGGCTGACGGCTAGACAGTCATTGGCGCTGGCACTCTGGCTAT
GCCCTCTGTTCTGTCTCATATGGGCATCATGCTCGGCGTCGTCCTCATACTCTGGTCGGGCATCACGGCCGCCTT
TGGCCTCTACCTGCAGTCACGCTGCGCCCGCTATCTCGACCGCGGCACGTCGTCCTTTTTCGCCCTATCGCAAAT
CACATATCCCAATGCCTCGGTCATCTTCGATCTGGCAATCGCCGTCAAGTGCTTTGGTGTCGCCATCTCCTACAT
GATCATCATTGGCGATCTCATGCCCGGCGTCATGCTCGGCTTCAACGACGCCGTCGCCGACATTCCATATCTAGT
CGACAGACATTTCTGGATCACGGCCTTTATGCTCCTCATCATTCCGCTGAGCTTCTTGCGCAGGCTCGACTCGCT
CAAGTATACCAGCCTCATCGGCCTGGTCTCCATCGGCTATCTCATTGTCCTCGTCATTTACCACTTCGCCGCCGA
CGCCCACGCTGACCCGCGCGATATTCGAGTTATCCAATGGGCTGGGCCGGTCGAAACGCTGAGCGCGCTTCCCGT
CGTCGTCTTCGCCTATACGTGCCATCAGAATGCAAGTCGTCTCCTGCCCCTAAAACCCCCCCGGAGAAACGTATT
TTAGCTGATGCTGGGAGCAGATGTTCTCCATAATCAACGAGATCAAAGACAACTCTCCCGCGAGCATGGTCGAGG
TGGTGGCTTCGAGCATCGGTTCCGCCGCGTGCATCTACGTTCTCGTAGCCATTACGGGCTACATTACGTTTGGAA
ACTTCATCGTCGGCAACATCATCTCCATGTGTAAGGCAGCGAAAAATCCCCCATGGCCGTCGCGCGCATGACCTG
ACGGTGGCAAGTGCAGATCCCACCGGCGTCGCATCTACCATTGGCAAGGCCGCCATTGTCCTCCTCGTCCTCTTC
TCCATTCCGCTGCAGATTCACCCCTGCCGCGCCTCTCTGCACGCCGTCCTCAAGTGGCGTCCCAACCGGTCAGGC
GCCAATGCCGGCCGGCCAGGCTCTCCGCTGTTCAATGCGTCGGCCGTGCCGCGCGGCGACCACGGCAGCAGCACG
CCCATCTCGGACACGCGATTTGCCATCCTTACCACGGCCATCCTGACGCTAGCCTACATGACGGCGCTGTCTGTC
AGCAGCCTGGACCGCGTCCTCGCTTTCGTCGGCAGCACGGGCTCGACATCCATCAGCTTCATCCTCCCGGGCCTG
TTCTACTACAAGATTAGCGACCCGGAGAGCATCCACCACCAGCGTCTGATCAAGGGAGACGACGACATGGACGAC
GAGCCCTCGTCAGACGTCGAGGAGATCGCCGGCGGAATGCTGGCACAGAGCACGTCTAGCATACGAGGTGGTACC
GGCGCCGTCACCGGCTCGCAGCCGCGCTGGCGATGGCGACGGAAATGGAGATGGGATCTGGAACACCTCGATCAC
CAGTTGACGAGGAAGCTAGCGCTCTCGCTAGCAGCCTACGGCATCGTCGTCATGACCGTCTGCCTGCTAATGAAC
ATATTCTTTGCGGTCGCTCATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail