Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02666
Gene name
Locationscaffold_02:4373448..4374502
Strand-
Gene length (bp)1054
Transcript length (bp)939
Coding sequence length (bp)939
Protein length (aa) 313

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00018 SH3_1 SH3 domain 7.8E-08 259 306

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.5

Transmembrane Domains

Domain # Start End Length
1 36 58 22
2 71 93 22
3 103 125 22
4 132 154 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 40.10 20.16 60.04
Alive In ants, during behavior modification 124.79 69.49 180.08
Dead In ants, recently dead 140.50 79.79 201.21

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.520966 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02666
MPPYGSLDSPSMSKMEQSRSYGRNGFRLGNILGDPFALATTSISALAWLITFISCIISQVQPTPRDETPFPPFAW
WAVVYSFFLIGGIFVVVASDAVHTYHVAITGYLAAGLVLVTSGVNSLVYSKSGAREAAAAGFILLSILVIIWILY
FGSTPSATPRAFIDSFALAKDSSAMQGQPMNAYGSGRPETSNSVQPPQMYTSAQLNGFENSSPIGNVSQVNGPRN
STGPMGFASTTQQHHPKSNDVEVVAPTEYPYQAKAIYSYEANPDDANEITFVKHEILEVSDVSGRWWQARKQNGE
IGIAPSNYLILL*
Coding >Ophcf2|02666
ATGCCCCCTTACGGCTCCTTGGACTCGCCTTCCATGAGCAAAATGGAGCAATCGCGCAGCTATGGCCGCAATGGC
TTCCGGCTGGGCAACATCTTGGGCGATCCCTTTGCCCTCGCCACCACCTCCATATCAGCCCTCGCATGGCTCATC
ACCTTCATCTCGTGCATAATTTCTCAAGTACAGCCGACGCCTCGGGATGAAACACCCTTCCCACCATTTGCTTGG
TGGGCCGTCGTCTACAGCTTCTTCCTCATTGGCGGCATCTTCGTCGTCGTCGCTAGCGATGCCGTTCACACCTAT
CACGTCGCCATCACCGGTTACCTCGCCGCCGGCTTGGTCCTCGTCACTTCGGGCGTCAATTCTCTCGTCTACTCC
AAGAGCGGGGCCAGAGAAGCCGCTGCTGCCGGCTTCATCCTGCTGTCCATTCTGGTGATTATCTGGATCCTCTAT
TTCGGCTCCACGCCTTCGGCCACGCCCCGTGCCTTCATCGACTCCTTCGCCCTGGCCAAGGACTCGTCCGCCATG
CAGGGTCAGCCGATGAACGCCTACGGCTCTGGCCGGCCCGAGACATCCAACTCGGTACAGCCTCCGCAGATGTAC
ACCTCGGCTCAGCTCAACGGCTTCGAGAACTCGTCGCCCATTGGCAACGTCTCACAGGTAAACGGCCCCCGCAAC
TCGACGGGGCCCATGGGTTTCGCCAGCACCACGCAGCAGCACCACCCAAAATCAAATGATGTCGAGGTCGTCGCC
CCTACCGAGTACCCCTACCAAGCCAAGGCCATCTACAGCTACGAGGCCAACCCCGACGACGCCAACGAAATCACC
TTTGTCAAGCACGAAATCCTCGAGGTGTCCGACGTAAGCGGGCGCTGGTGGCAGGCGCGGAAACAGAACGGCGAG
ATTGGCATCGCCCCGAGCAACTATCTCATCCTATTATAG
Transcript >Ophcf2|02666
ATGCCCCCTTACGGCTCCTTGGACTCGCCTTCCATGAGCAAAATGGAGCAATCGCGCAGCTATGGCCGCAATGGC
TTCCGGCTGGGCAACATCTTGGGCGATCCCTTTGCCCTCGCCACCACCTCCATATCAGCCCTCGCATGGCTCATC
ACCTTCATCTCGTGCATAATTTCTCAAGTACAGCCGACGCCTCGGGATGAAACACCCTTCCCACCATTTGCTTGG
TGGGCCGTCGTCTACAGCTTCTTCCTCATTGGCGGCATCTTCGTCGTCGTCGCTAGCGATGCCGTTCACACCTAT
CACGTCGCCATCACCGGTTACCTCGCCGCCGGCTTGGTCCTCGTCACTTCGGGCGTCAATTCTCTCGTCTACTCC
AAGAGCGGGGCCAGAGAAGCCGCTGCTGCCGGCTTCATCCTGCTGTCCATTCTGGTGATTATCTGGATCCTCTAT
TTCGGCTCCACGCCTTCGGCCACGCCCCGTGCCTTCATCGACTCCTTCGCCCTGGCCAAGGACTCGTCCGCCATG
CAGGGTCAGCCGATGAACGCCTACGGCTCTGGCCGGCCCGAGACATCCAACTCGGTACAGCCTCCGCAGATGTAC
ACCTCGGCTCAGCTCAACGGCTTCGAGAACTCGTCGCCCATTGGCAACGTCTCACAGGTAAACGGCCCCCGCAAC
TCGACGGGGCCCATGGGTTTCGCCAGCACCACGCAGCAGCACCACCCAAAATCAAATGATGTCGAGGTCGTCGCC
CCTACCGAGTACCCCTACCAAGCCAAGGCCATCTACAGCTACGAGGCCAACCCCGACGACGCCAACGAAATCACC
TTTGTCAAGCACGAAATCCTCGAGGTGTCCGACGTAAGCGGGCGCTGGTGGCAGGCGCGGAAACAGAACGGCGAG
ATTGGCATCGCCCCGAGCAACTATCTCATCCTATTATAG
Gene >Ophcf2|02666
ATGCCCCCTTACGGCTCCTTGGACTCGCCTTCCATGAGCAAAATGGAGCAATCGCGCAGCTATGGCCGCAATGGC
TTCCGGCTGGGCAACATCTTGGGCGATCCCTTTGCCCTCGCCACCACCTCCATATCAGCCGTACGTCTTTCTCCC
TCCCTGTCCTGTCGCTCTCGTCGTTCCGTCGCTAATTGCCCTGCCCCCACAGCTCGCATGGCTCATCACCTTCAT
CTCGTGCATAATTTCTCAAGTACAGCCGACGCCTCGGGATGAAACACCCTTCCCACCATTTGCTTGGTGGGCCGT
CGTCTACAGCTTCTTCCTCATTGGCGGCATCTTCGTCGTCGTCGCTAGCGATGCCGTTCACACCTATCACGTCGC
CATCACCGGTTACCTCGCCGCCGGCTTGGTCCTCGTCACTTCGGGCGTCAATTCTCTCGTCTACTCCAAGAGCGG
GGCCAGAGAAGCCGCTGCTGCCGGCTTCATCCTGCTGTCCATTCTGGTGGTGAGTGCGCATCGTGACCCGGCGGC
CCTACACGTGCTAACCATTTAGATTATCTGGATCCTCTATTTCGGCTCCACGCCTTCGGCCACGCCCCGTGCCTT
CATCGACTCCTTCGCCCTGGCCAAGGACTCGTCCGCCATGCAGGGTCAGCCGATGAACGCCTACGGCTCTGGCCG
GCCCGAGACATCCAACTCGGTACAGCCTCCGCAGATGTACACCTCGGCTCAGCTCAACGGCTTCGAGAACTCGTC
GCCCATTGGCAACGTCTCACAGGTAAACGGCCCCCGCAACTCGACGGGGCCCATGGGTTTCGCCAGCACCACGCA
GCAGCACCACCCAAAATCAAATGATGTCGAGGTCGTCGCCCCTACCGAGTACCCCTACCAAGCCAAGGCCATCTA
CAGCTACGAGGCCAACCCCGACGACGCCAACGAAATCACCTTTGTCAAGCACGAAATCCTCGAGGTGTCCGACGT
AAGCGGGCGCTGGTGGCAGGCGCGGAAACAGAACGGCGAGATTGGCATCGCCCCGAGCAACTATCTCATCCTATT
ATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail