Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02664
Gene name
Locationscaffold_02:4369799..4370831
Strand-
Gene length (bp)1032
Transcript length (bp)918
Coding sequence length (bp)918
Protein length (aa) 306

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 131 153 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 18.02 7.41 28.62
Alive In ants, during behavior modification 14.66 5.36 23.95
Dead In ants, recently dead 14.23 5.18 23.29

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.488498 no
Alive Dead 0.926954 no
Dead Fungus 0.413129 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02664
MTVHPTDAATQGMAIHGLRFLNDEWNDSISNGDVFTVRWNQSLAKTGSGLGVFQVTYPKDGVVVYELVSNLTDAI
EGDGASCKWTPQNLDKQGLYAMWLTSGQATHPNWTLSPPWVPKAGAGSQGTPWAAPFLIPVICLLGLYAISLTGY
LVYRRRKKARTEKARTDPGMILRGRNVSIDSPITAQALRRPETGIEKQGIVGMVNAEPDMEEHIGVNSLPGIGRT
ARRTDDDDDEYDDDDLGHHMPRNPAGRGIRIVTSSGPKSEAEERLLMTPVQSAGSAVSSTQVTPVGRNFSRPVQT
QRIFS*
Coding >Ophcf2|02664
ATGACGGTTCACCCAACAGACGCGGCCACTCAGGGCATGGCCATTCACGGCCTTCGATTCCTCAACGATGAATGG
AACGATAGCATTTCCAACGGCGACGTCTTCACCGTCCGATGGAACCAGTCTCTTGCCAAAACCGGCTCCGGCCTG
GGCGTGTTCCAAGTAACGTATCCGAAGGACGGCGTCGTCGTGTACGAGCTGGTATCGAATCTGACTGATGCAATC
GAGGGAGACGGCGCCTCGTGTAAATGGACGCCGCAGAACCTGGATAAACAGGGCCTGTATGCCATGTGGCTCACG
TCTGGCCAGGCCACCCACCCCAATTGGACCCTGTCACCCCCTTGGGTCCCCAAAGCAGGCGCCGGATCGCAGGGA
ACTCCCTGGGCAGCGCCCTTTCTCATCCCCGTCATATGTCTACTCGGCCTCTACGCCATCTCCCTGACAGGCTAT
CTGGTCTATCGACGCCGGAAAAAGGCCAGGACGGAGAAGGCCCGGACGGATCCTGGCATGATCCTTCGCGGCCGC
AATGTATCCATCGACTCGCCCATCACGGCACAAGCCCTTCGCAGGCCCGAGACCGGCATAGAGAAGCAGGGCATC
GTCGGAATGGTCAACGCTGAACCTGACATGGAAGAGCATATCGGAGTTAACAGCTTGCCCGGCATAGGCCGCACA
GCTCGAAGAACCGACGACGATGACGACGAATACGATGACGATGACCTCGGCCACCACATGCCCCGGAATCCGGCC
GGCCGCGGCATCCGCATCGTCACCTCGAGCGGCCCGAAATCGGAAGCAGAAGAGCGGCTGCTGATGACGCCCGTC
CAGAGCGCCGGATCGGCCGTCTCGAGCACCCAAGTAACACCCGTCGGCCGCAACTTTTCCCGGCCTGTACAAACA
CAGAGGATCTTTTCATAG
Transcript >Ophcf2|02664
ATGACGGTTCACCCAACAGACGCGGCCACTCAGGGCATGGCCATTCACGGCCTTCGATTCCTCAACGATGAATGG
AACGATAGCATTTCCAACGGCGACGTCTTCACCGTCCGATGGAACCAGTCTCTTGCCAAAACCGGCTCCGGCCTG
GGCGTGTTCCAAGTAACGTATCCGAAGGACGGCGTCGTCGTGTACGAGCTGGTATCGAATCTGACTGATGCAATC
GAGGGAGACGGCGCCTCGTGTAAATGGACGCCGCAGAACCTGGATAAACAGGGCCTGTATGCCATGTGGCTCACG
TCTGGCCAGGCCACCCACCCCAATTGGACCCTGTCACCCCCTTGGGTCCCCAAAGCAGGCGCCGGATCGCAGGGA
ACTCCCTGGGCAGCGCCCTTTCTCATCCCCGTCATATGTCTACTCGGCCTCTACGCCATCTCCCTGACAGGCTAT
CTGGTCTATCGACGCCGGAAAAAGGCCAGGACGGAGAAGGCCCGGACGGATCCTGGCATGATCCTTCGCGGCCGC
AATGTATCCATCGACTCGCCCATCACGGCACAAGCCCTTCGCAGGCCCGAGACCGGCATAGAGAAGCAGGGCATC
GTCGGAATGGTCAACGCTGAACCTGACATGGAAGAGCATATCGGAGTTAACAGCTTGCCCGGCATAGGCCGCACA
GCTCGAAGAACCGACGACGATGACGACGAATACGATGACGATGACCTCGGCCACCACATGCCCCGGAATCCGGCC
GGCCGCGGCATCCGCATCGTCACCTCGAGCGGCCCGAAATCGGAAGCAGAAGAGCGGCTGCTGATGACGCCCGTC
CAGAGCGCCGGATCGGCCGTCTCGAGCACCCAAGTAACACCCGTCGGCCGCAACTTTTCCCGGCCTGTACAAACA
CAGAGGATCTTTTCATAG
Gene >Ophcf2|02664
ATGACGGTTCACCCAACAGACGCGGCCACTCAGGGCATGGCCATTCACGGCCTTCGATTCCTCAACGATGAATGG
AACGATAGCATTTCCAACGGCGACGTCTTCACCGTCCGATGGAACCAGTCTCTTGCCAAAACCGGCTCCGGCCTG
GGCGTGTTCCAAGTAACGTATCCGAAGGACGGCGTCGTCGTGTACGAGCTGGTATCGAATCTGACTGGTCTGTAG
CCCGTCGTGCTATCACTCTCTTGTACGGCTCACTGACCGAGTCTCTGTGATAGATGCAATCGAGGGAGACGGCGC
CTCGTGTAAATGGACGCCGCAGAACCTGGATAAACAGGGCCTGTATGCCATGTGGCTCACGTCTGGCCAGGCCAC
CCACCCCAATTGGACCCTGTCACCCCCTTGGGTCCCCAAAGCAGGCGTTGGTTCCCATCCCCTCGTTTCCCGCCC
GAGCGCCGGTCTAACGGAGACAAGGCCGGATCGCAGGGAACTCCCTGGGCAGCGCCCTTTCTCATCCCCGTCATA
TGTCTACTCGGCCTCTACGCCATCTCCCTGACAGGCTATCTGGTCTATCGACGCCGGAAAAAGGCCAGGACGGAG
AAGGCCCGGACGGATCCTGGCATGATCCTTCGCGGCCGCAATGTATCCATCGACTCGCCCATCACGGCACAAGCC
CTTCGCAGGCCCGAGACCGGCATAGAGAAGCAGGGCATCGTCGGAATGGTCAACGCTGAACCTGACATGGAAGAG
CATATCGGAGTTAACAGCTTGCCCGGCATAGGCCGCACAGCTCGAAGAACCGACGACGATGACGACGAATACGAT
GACGATGACCTCGGCCACCACATGCCCCGGAATCCGGCCGGCCGCGGCATCCGCATCGTCACCTCGAGCGGCCCG
AAATCGGAAGCAGAAGAGCGGCTGCTGATGACGCCCGTCCAGAGCGCCGGATCGGCCGTCTCGAGCACCCAAGTA
ACACCCGTCGGCCGCAACTTTTCCCGGCCTGTACAAACACAGAGGATCTTTTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail