Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02662
Gene name
Locationscaffold_02:4365096..4366733
Strand-
Gene length (bp)1637
Transcript length (bp)1452
Coding sequence length (bp)1452
Protein length (aa) 484

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01399 PCI PCI domain 6.4E-22 327 438
PF18098 RPN5_C 26S proteasome regulatory subunit RPN5 C-terminal domain 5.7E-16 444 476

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.7034 0.7185 0.0381 0.0811 0.0684 0.0109 0.088 0.3941 0.4448 0.0008

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 251.75 128.03 375.47
Alive In ants, during behavior modification 205.72 107.10 304.35
Dead In ants, recently dead 188.14 99.33 276.95

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.375013 no
Alive Dead 0.668809 no
Dead Fungus 0.171987 no

Orthologs

Orthofinder run ID4
Orthogroup764
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1522
Ophiocordyceps australis 1348a (Ghana) OphauG2|7699
Ophiocordyceps australis map64 (Brazil) OphauB2|1512
Ophiocordyceps camponoti-floridani Ophcf2|02662 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7383
Ophiocordyceps kimflemingae Ophio5|2223
Ophiocordyceps subramaniannii Hirsu2|2585

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02662
MSEGTLKPEKDFSKEVDQQLPEAEALAKTNLQGAIEKLTALEKQTRQASDLASTSRVIIAIVTLCKNAGDWSLMN
DQTLVLSKKHSQLKQAITKMVQTVVGFLDDTPDIKTKLSVIDTLRTVTEGKIFVEVERARVTKILSDMKKSQGEL
KAATEILCELQVETFGSMGRREKTEFILAQVALCIESGDWTQAGILARKISTKYLSRKPKKTAVELEKARQEREK
KRGPGEEEVRDDLDDDTTDLRLRYYEQQIMLAKHEGKYLDVCKHYRQVLDTEAVEEDPAKLHPVLQRIIYFAILA
PYDNEQHDLLHRIHRDTRNSQIPMDAELLRFFTVHELMRWPEIANKFGPHLCSTDVFDSQAGQSSDDKAHQRWED
LRKRVIEHNVRVVAKYYTRIQMKRLTELLDLTEDETEKYISELVTSKTVYAKIDRPARVVSFAKPSSADDVLNEW
SHNMKNLLGLLERIDHLITKEEMMARIQPTSAK*
Coding >Ophcf2|02662
ATGTCCGAGGGAACGCTGAAGCCCGAGAAGGACTTCTCCAAGGAGGTCGACCAACAGCTTCCAGAGGCCGAAGCG
CTGGCAAAGACCAACCTGCAAGGAGCCATCGAGAAGCTCACAGCGTTGGAGAAACAGACGCGTCAAGCTTCGGAT
CTGGCGTCGACATCGCGCGTCATAATCGCCATCGTCACCCTCTGCAAAAATGCCGGCGACTGGAGCTTGATGAAC
GATCAGACGCTGGTTCTGTCCAAGAAGCACAGTCAGCTCAAGCAGGCCATCACCAAGATGGTTCAAACCGTCGTT
GGCTTCCTTGACGACACGCCCGACATCAAGACGAAGCTCTCCGTCATCGACACGCTGCGGACGGTTACCGAGGGC
AAGATCTTCGTCGAAGTTGAGCGCGCTCGCGTCACCAAGATTCTCTCGGATATGAAAAAGTCCCAAGGCGAACTC
AAGGCCGCCACCGAGATTCTCTGCGAGCTGCAGGTCGAGACTTTTGGCTCCATGGGTCGACGGGAGAAGACAGAG
TTCATTCTGGCTCAGGTCGCTCTCTGTATTGAGAGCGGCGACTGGACGCAGGCCGGCATCCTGGCCCGCAAAATC
AGCACCAAGTACCTGTCCCGCAAGCCCAAGAAGACAGCCGTGGAACTGGAAAAGGCCAGACAGGAGCGCGAGAAG
AAGAGGGGGCCCGGCGAGGAGGAAGTCCGCGATGACTTGGACGATGATACGACGGACTTGAGGCTGCGCTACTAC
GAGCAGCAAATCATGCTTGCCAAGCACGAGGGCAAATATCTCGACGTCTGCAAGCACTACCGGCAGGTTCTCGAC
ACGGAGGCCGTAGAAGAGGACCCGGCCAAACTTCATCCCGTCCTTCAACGCATCATCTACTTTGCCATCCTCGCC
CCTTACGACAACGAACAGCACGACCTCCTCCACCGCATCCACCGCGATACGCGCAACTCGCAAATTCCCATGGAC
GCCGAGCTCCTCCGCTTCTTCACCGTGCACGAGCTGATGCGGTGGCCCGAGATTGCCAACAAGTTTGGCCCGCAC
CTGTGCAGCACCGACGTCTTCGATTCCCAGGCCGGCCAGTCTTCGGACGACAAGGCGCATCAGCGATGGGAGGAT
CTCCGGAAGCGCGTCATCGAGCACAACGTCCGCGTCGTGGCCAAGTATTACACGCGCATACAGATGAAGCGCCTG
ACGGAACTCCTGGACCTGACGGAGGACGAGACGGAAAAGTACATCAGCGAACTGGTCACGTCCAAGACGGTATAT
GCCAAGATTGATCGGCCGGCGCGCGTCGTCAGCTTCGCCAAGCCTAGCAGCGCCGACGATGTGCTGAACGAATGG
AGCCACAACATGAAGAATCTGCTTGGTTTGCTGGAGAGGATCGATCACCTGATTACCAAGGAGGAGATGATGGCT
CGCATACAGCCGACGAGCGCAAAGTAG
Transcript >Ophcf2|02662
ATGTCCGAGGGAACGCTGAAGCCCGAGAAGGACTTCTCCAAGGAGGTCGACCAACAGCTTCCAGAGGCCGAAGCG
CTGGCAAAGACCAACCTGCAAGGAGCCATCGAGAAGCTCACAGCGTTGGAGAAACAGACGCGTCAAGCTTCGGAT
CTGGCGTCGACATCGCGCGTCATAATCGCCATCGTCACCCTCTGCAAAAATGCCGGCGACTGGAGCTTGATGAAC
GATCAGACGCTGGTTCTGTCCAAGAAGCACAGTCAGCTCAAGCAGGCCATCACCAAGATGGTTCAAACCGTCGTT
GGCTTCCTTGACGACACGCCCGACATCAAGACGAAGCTCTCCGTCATCGACACGCTGCGGACGGTTACCGAGGGC
AAGATCTTCGTCGAAGTTGAGCGCGCTCGCGTCACCAAGATTCTCTCGGATATGAAAAAGTCCCAAGGCGAACTC
AAGGCCGCCACCGAGATTCTCTGCGAGCTGCAGGTCGAGACTTTTGGCTCCATGGGTCGACGGGAGAAGACAGAG
TTCATTCTGGCTCAGGTCGCTCTCTGTATTGAGAGCGGCGACTGGACGCAGGCCGGCATCCTGGCCCGCAAAATC
AGCACCAAGTACCTGTCCCGCAAGCCCAAGAAGACAGCCGTGGAACTGGAAAAGGCCAGACAGGAGCGCGAGAAG
AAGAGGGGGCCCGGCGAGGAGGAAGTCCGCGATGACTTGGACGATGATACGACGGACTTGAGGCTGCGCTACTAC
GAGCAGCAAATCATGCTTGCCAAGCACGAGGGCAAATATCTCGACGTCTGCAAGCACTACCGGCAGGTTCTCGAC
ACGGAGGCCGTAGAAGAGGACCCGGCCAAACTTCATCCCGTCCTTCAACGCATCATCTACTTTGCCATCCTCGCC
CCTTACGACAACGAACAGCACGACCTCCTCCACCGCATCCACCGCGATACGCGCAACTCGCAAATTCCCATGGAC
GCCGAGCTCCTCCGCTTCTTCACCGTGCACGAGCTGATGCGGTGGCCCGAGATTGCCAACAAGTTTGGCCCGCAC
CTGTGCAGCACCGACGTCTTCGATTCCCAGGCCGGCCAGTCTTCGGACGACAAGGCGCATCAGCGATGGGAGGAT
CTCCGGAAGCGCGTCATCGAGCACAACGTCCGCGTCGTGGCCAAGTATTACACGCGCATACAGATGAAGCGCCTG
ACGGAACTCCTGGACCTGACGGAGGACGAGACGGAAAAGTACATCAGCGAACTGGTCACGTCCAAGACGGTATAT
GCCAAGATTGATCGGCCGGCGCGCGTCGTCAGCTTCGCCAAGCCTAGCAGCGCCGACGATGTGCTGAACGAATGG
AGCCACAACATGAAGAATCTGCTTGGTTTGCTGGAGAGGATCGATCACCTGATTACCAAGGAGGAGATGATGGCT
CGCATACAGCCGACGAGCGCAAAGTAG
Gene >Ophcf2|02662
ATGTCCGAGGGAACGCTGAAGCCCGAGAAGGACTTCTCCAAGGAGGTCGACCAACAGCTTCCAGAGGCCGAAGCG
CTGGCAAAGGTCAGCAGCCGAAGCCGTTCCGACCCAGCTGCTGACCGAGGTACTGATGGGCTGCCTCTTCATAGA
CCAACCTGCAAGGAGCCATCGAGAAGCTCACAGCGTTGGAGAAACAGACGCGTCAAGTCAGTCGCCGCTTCTCTC
GCCTTGAAGCCACCGTTACCTCTCTGACTAGCGTCGCAGGCTTCGGATCTGGCGTCGACATCGCGCGTCATAATC
GCCATCGTCACCCTCTGCAAAAATGCCGGCGACTGGAGCTTGATGAACGATCAGACGCTGGTTCTGTCCAAGAAG
CACAGTCAGCTCAAGCAGGCCATCACCAAGATGGTTCAAACCGTCGTTGGCTTCCTTGACGACACGCCCGACATC
AAGACGAAGCTCTCCGTCATCGACACGCTGCGGACGGTTACCGAGGGCAAGATCTTCGTCGAAGTTGAGCGCGCT
CGCGTCACCAAGATTCTCTCGGATATGAAAAAGTCCCAAGGCGAACTCAAGGCCGCCACCGAGATTCTCTGCGAG
CTGCAGGTCGAGACTTTTGGCTCCATGGGTCGACGGGAGAAGACAGAGTTCATTCTGGCTCAGGTCGCTCTCTGT
ATTGAGAGCGGCGACTGGACGCAGGCCGGCATCCTGGCCCGCAAAATCAGCACCAAGTACCTGTCCCGCAAGCCC
AAGAAGACAGCCGTGGAACTGGAAAAGGCCAGACAGGAGCGCGAGAAGAAGAGGGGGCCCGGCGAGGAGGAAGTC
CGCGATGACTTGGACGATGATACGACGGACTTGAGGCTGCGCTACTACGAGCAGCAAATCATGCTTGCCAAGCAC
GAGGGCAAATATCTCGACGTCTGCAAGCACTACCGGCAGGTTCTCGACACGGAGGCCGTAGAAGAGGACCCGGCC
AAACTTCATCCCGTACGTCCCTTTCCATTGTGTCTTGGATTGAGCCACCTCTGCTGACGTGCTCGCCCTGAAAGG
TCCTTCAACGCATCATCTACTTTGCCATCCTCGCCCCTTACGACAACGAACAGCACGACCTCCTCCACCGCATCC
ACCGCGATACGCGCAACTCGCAAATTCCCATGGACGCCGAGCTCCTCCGCTTCTTCACCGTGCACGAGCTGATGC
GGTGGCCCGAGATTGCCAACAAGTTTGGCCCGCACCTGTGCAGCACCGACGTCTTCGATTCCCAGGCCGGCCAGT
CTTCGGACGACAAGGCGCATCAGCGATGGGAGGATCTCCGGAAGCGCGTCATCGAGCACAACGTCCGCGTCGTGG
CCAAGTATTACACGCGCATACAGATGAAGCGCCTGACGGAACTCCTGGACCTGACGGAGGACGAGACGGAAAAGT
ACATCAGCGAACTGGTCACGTCCAAGACGGTATATGCCAAGATTGATCGGCCGGCGCGCGTCGTCAGCTTCGCCA
AGCCTAGCAGCGCCGACGATGTGCTGAACGAATGGAGCCACAACATGAAGAATCTGCTTGGTTTGCTGGAGAGGA
TCGATCACCTGATTACCAAGGAGGAGATGATGGCTCGCATACAGCCGACGAGCGCAAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail