Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02662
Gene name
Locationscaffold_02:4365096..4366733
Strand-
Gene length (bp)1637
Transcript length (bp)1452
Coding sequence length (bp)1452
Protein length (aa) 484

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01399 PCI PCI domain 6.4E-22 327 438
PF18098 RPN5_C 26S proteasome regulatory subunit RPN5 C-terminal domain 5.7E-16 444 476

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.7034 0.7185 0.0381 0.0811 0.0684 0.0109 0.088 0.3941 0.4448 0.0008

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup764
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1522
Ophiocordyceps australis 1348a (Ghana) OphauG2|7699
Ophiocordyceps australis map64 (Brazil) OphauB2|1512
Ophiocordyceps camponoti-floridani Ophcf2|02662 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7383
Ophiocordyceps kimflemingae Ophio5|2223
Ophiocordyceps subramaniannii Hirsu2|2585

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02662
MSEGTLKPEKDFSKEVDQQLPEAEALAKTNLQGAIEKLTALEKQTRQASDLASTSRVIIAIVTLCKNAGDWSLMN
DQTLVLSKKHSQLKQAITKMVQTVVGFLDDTPDIKTKLSVIDTLRTVTEGKIFVEVERARVTKILSDMKKSQGEL
KAATEILCELQVETFGSMGRREKTEFILAQVALCIESGDWTQAGILARKISTKYLSRKPKKTAVELEKARQEREK
KRGPGEEEVRDDLDDDTTDLRLRYYEQQIMLAKHEGKYLDVCKHYRQVLDTEAVEEDPAKLHPVLQRIIYFAILA
PYDNEQHDLLHRIHRDTRNSQIPMDAELLRFFTVHELMRWPEIANKFGPHLCSTDVFDSQAGQSSDDKAHQRWED
LRKRVIEHNVRVVAKYYTRIQMKRLTELLDLTEDETEKYISELVTSKTVYAKIDRPARVVSFAKPSSADDVLNEW
SHNMKNLLGLLERIDHLITKEEMMARIQPTSAK*
Coding >Ophcf2|02662
ATGTCCGAGGGAACGCTGAAGCCCGAGAAGGACTTCTCCAAGGAGGTCGACCAACAGCTTCCAGAGGCCGAAGCG
CTGGCAAAGACCAACCTGCAAGGAGCCATCGAGAAGCTCACAGCGTTGGAGAAACAGACGCGTCAAGCTTCGGAT
CTGGCGTCGACATCGCGCGTCATAATCGCCATCGTCACCCTCTGCAAAAATGCCGGCGACTGGAGCTTGATGAAC
GATCAGACGCTGGTTCTGTCCAAGAAGCACAGTCAGCTCAAGCAGGCCATCACCAAGATGGTTCAAACCGTCGTT
GGCTTCCTTGACGACACGCCCGACATCAAGACGAAGCTCTCCGTCATCGACACGCTGCGGACGGTTACCGAGGGC
AAGATCTTCGTCGAAGTTGAGCGCGCTCGCGTCACCAAGATTCTCTCGGATATGAAAAAGTCCCAAGGCGAACTC
AAGGCCGCCACCGAGATTCTCTGCGAGCTGCAGGTCGAGACTTTTGGCTCCATGGGTCGACGGGAGAAGACAGAG
TTCATTCTGGCTCAGGTCGCTCTCTGTATTGAGAGCGGCGACTGGACGCAGGCCGGCATCCTGGCCCGCAAAATC
AGCACCAAGTACCTGTCCCGCAAGCCCAAGAAGACAGCCGTGGAACTGGAAAAGGCCAGACAGGAGCGCGAGAAG
AAGAGGGGGCCCGGCGAGGAGGAAGTCCGCGATGACTTGGACGATGATACGACGGACTTGAGGCTGCGCTACTAC
GAGCAGCAAATCATGCTTGCCAAGCACGAGGGCAAATATCTCGACGTCTGCAAGCACTACCGGCAGGTTCTCGAC
ACGGAGGCCGTAGAAGAGGACCCGGCCAAACTTCATCCCGTCCTTCAACGCATCATCTACTTTGCCATCCTCGCC
CCTTACGACAACGAACAGCACGACCTCCTCCACCGCATCCACCGCGATACGCGCAACTCGCAAATTCCCATGGAC
GCCGAGCTCCTCCGCTTCTTCACCGTGCACGAGCTGATGCGGTGGCCCGAGATTGCCAACAAGTTTGGCCCGCAC
CTGTGCAGCACCGACGTCTTCGATTCCCAGGCCGGCCAGTCTTCGGACGACAAGGCGCATCAGCGATGGGAGGAT
CTCCGGAAGCGCGTCATCGAGCACAACGTCCGCGTCGTGGCCAAGTATTACACGCGCATACAGATGAAGCGCCTG
ACGGAACTCCTGGACCTGACGGAGGACGAGACGGAAAAGTACATCAGCGAACTGGTCACGTCCAAGACGGTATAT
GCCAAGATTGATCGGCCGGCGCGCGTCGTCAGCTTCGCCAAGCCTAGCAGCGCCGACGATGTGCTGAACGAATGG
AGCCACAACATGAAGAATCTGCTTGGTTTGCTGGAGAGGATCGATCACCTGATTACCAAGGAGGAGATGATGGCT
CGCATACAGCCGACGAGCGCAAAGTAG
Transcript >Ophcf2|02662
ATGTCCGAGGGAACGCTGAAGCCCGAGAAGGACTTCTCCAAGGAGGTCGACCAACAGCTTCCAGAGGCCGAAGCG
CTGGCAAAGACCAACCTGCAAGGAGCCATCGAGAAGCTCACAGCGTTGGAGAAACAGACGCGTCAAGCTTCGGAT
CTGGCGTCGACATCGCGCGTCATAATCGCCATCGTCACCCTCTGCAAAAATGCCGGCGACTGGAGCTTGATGAAC
GATCAGACGCTGGTTCTGTCCAAGAAGCACAGTCAGCTCAAGCAGGCCATCACCAAGATGGTTCAAACCGTCGTT
GGCTTCCTTGACGACACGCCCGACATCAAGACGAAGCTCTCCGTCATCGACACGCTGCGGACGGTTACCGAGGGC
AAGATCTTCGTCGAAGTTGAGCGCGCTCGCGTCACCAAGATTCTCTCGGATATGAAAAAGTCCCAAGGCGAACTC
AAGGCCGCCACCGAGATTCTCTGCGAGCTGCAGGTCGAGACTTTTGGCTCCATGGGTCGACGGGAGAAGACAGAG
TTCATTCTGGCTCAGGTCGCTCTCTGTATTGAGAGCGGCGACTGGACGCAGGCCGGCATCCTGGCCCGCAAAATC
AGCACCAAGTACCTGTCCCGCAAGCCCAAGAAGACAGCCGTGGAACTGGAAAAGGCCAGACAGGAGCGCGAGAAG
AAGAGGGGGCCCGGCGAGGAGGAAGTCCGCGATGACTTGGACGATGATACGACGGACTTGAGGCTGCGCTACTAC
GAGCAGCAAATCATGCTTGCCAAGCACGAGGGCAAATATCTCGACGTCTGCAAGCACTACCGGCAGGTTCTCGAC
ACGGAGGCCGTAGAAGAGGACCCGGCCAAACTTCATCCCGTCCTTCAACGCATCATCTACTTTGCCATCCTCGCC
CCTTACGACAACGAACAGCACGACCTCCTCCACCGCATCCACCGCGATACGCGCAACTCGCAAATTCCCATGGAC
GCCGAGCTCCTCCGCTTCTTCACCGTGCACGAGCTGATGCGGTGGCCCGAGATTGCCAACAAGTTTGGCCCGCAC
CTGTGCAGCACCGACGTCTTCGATTCCCAGGCCGGCCAGTCTTCGGACGACAAGGCGCATCAGCGATGGGAGGAT
CTCCGGAAGCGCGTCATCGAGCACAACGTCCGCGTCGTGGCCAAGTATTACACGCGCATACAGATGAAGCGCCTG
ACGGAACTCCTGGACCTGACGGAGGACGAGACGGAAAAGTACATCAGCGAACTGGTCACGTCCAAGACGGTATAT
GCCAAGATTGATCGGCCGGCGCGCGTCGTCAGCTTCGCCAAGCCTAGCAGCGCCGACGATGTGCTGAACGAATGG
AGCCACAACATGAAGAATCTGCTTGGTTTGCTGGAGAGGATCGATCACCTGATTACCAAGGAGGAGATGATGGCT
CGCATACAGCCGACGAGCGCAAAGTAG
Gene >Ophcf2|02662
ATGTCCGAGGGAACGCTGAAGCCCGAGAAGGACTTCTCCAAGGAGGTCGACCAACAGCTTCCAGAGGCCGAAGCG
CTGGCAAAGGTCAGCAGCCGAAGCCGTTCCGACCCAGCTGCTGACCGAGGTACTGATGGGCTGCCTCTTCATAGA
CCAACCTGCAAGGAGCCATCGAGAAGCTCACAGCGTTGGAGAAACAGACGCGTCAAGTCAGTCGCCGCTTCTCTC
GCCTTGAAGCCACCGTTACCTCTCTGACTAGCGTCGCAGGCTTCGGATCTGGCGTCGACATCGCGCGTCATAATC
GCCATCGTCACCCTCTGCAAAAATGCCGGCGACTGGAGCTTGATGAACGATCAGACGCTGGTTCTGTCCAAGAAG
CACAGTCAGCTCAAGCAGGCCATCACCAAGATGGTTCAAACCGTCGTTGGCTTCCTTGACGACACGCCCGACATC
AAGACGAAGCTCTCCGTCATCGACACGCTGCGGACGGTTACCGAGGGCAAGATCTTCGTCGAAGTTGAGCGCGCT
CGCGTCACCAAGATTCTCTCGGATATGAAAAAGTCCCAAGGCGAACTCAAGGCCGCCACCGAGATTCTCTGCGAG
CTGCAGGTCGAGACTTTTGGCTCCATGGGTCGACGGGAGAAGACAGAGTTCATTCTGGCTCAGGTCGCTCTCTGT
ATTGAGAGCGGCGACTGGACGCAGGCCGGCATCCTGGCCCGCAAAATCAGCACCAAGTACCTGTCCCGCAAGCCC
AAGAAGACAGCCGTGGAACTGGAAAAGGCCAGACAGGAGCGCGAGAAGAAGAGGGGGCCCGGCGAGGAGGAAGTC
CGCGATGACTTGGACGATGATACGACGGACTTGAGGCTGCGCTACTACGAGCAGCAAATCATGCTTGCCAAGCAC
GAGGGCAAATATCTCGACGTCTGCAAGCACTACCGGCAGGTTCTCGACACGGAGGCCGTAGAAGAGGACCCGGCC
AAACTTCATCCCGTACGTCCCTTTCCATTGTGTCTTGGATTGAGCCACCTCTGCTGACGTGCTCGCCCTGAAAGG
TCCTTCAACGCATCATCTACTTTGCCATCCTCGCCCCTTACGACAACGAACAGCACGACCTCCTCCACCGCATCC
ACCGCGATACGCGCAACTCGCAAATTCCCATGGACGCCGAGCTCCTCCGCTTCTTCACCGTGCACGAGCTGATGC
GGTGGCCCGAGATTGCCAACAAGTTTGGCCCGCACCTGTGCAGCACCGACGTCTTCGATTCCCAGGCCGGCCAGT
CTTCGGACGACAAGGCGCATCAGCGATGGGAGGATCTCCGGAAGCGCGTCATCGAGCACAACGTCCGCGTCGTGG
CCAAGTATTACACGCGCATACAGATGAAGCGCCTGACGGAACTCCTGGACCTGACGGAGGACGAGACGGAAAAGT
ACATCAGCGAACTGGTCACGTCCAAGACGGTATATGCCAAGATTGATCGGCCGGCGCGCGTCGTCAGCTTCGCCA
AGCCTAGCAGCGCCGACGATGTGCTGAACGAATGGAGCCACAACATGAAGAATCTGCTTGGTTTGCTGGAGAGGA
TCGATCACCTGATTACCAAGGAGGAGATGATGGCTCGCATACAGCCGACGAGCGCAAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail