Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02656
Gene name
Locationscaffold_02:4354640..4356020
Strand-
Gene length (bp)1380
Transcript length (bp)1380
Coding sequence length (bp)1380
Protein length (aa) 460

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.103 0.0889 0.8698 0.3732 0.0473 0.0047 0.2081 0.1117 0.1951 0.0011

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999646

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup147
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7960
Ophiocordyceps australis map64 (Brazil) OphauB2|840
Ophiocordyceps camponoti-floridani Ophcf2|02656 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06464
Ophiocordyceps camponoti-rufipedis Ophun1|4164
Ophiocordyceps camponoti-rufipedis Ophun1|6322
Ophiocordyceps kimflemingae Ophio5|1791
Ophiocordyceps kimflemingae Ophio5|2231
Ophiocordyceps kimflemingae Ophio5|447
Ophiocordyceps subramaniannii Hirsu2|10000
Ophiocordyceps subramaniannii Hirsu2|2074
Ophiocordyceps subramaniannii Hirsu2|389

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02656
MKYAYTIVGFALASSSFADECVRKCNEAHNACLGKPNAHRPTCASDYAACLGYNPYTQGDYSTPTACSKAAQPTD
SPSPEACDCAKNCNYEYNACRGKPDANRSTCAASYSTCLGYSPFGPDGSLIPPTACAPGAARAGAPGGGAPSGVA
PGIGAPATDSPTIETPPGEDTGSSVVPGQGDYPGTFPGGVPSGVGPVTGYPPSESTPSAAVPVGNGPSGSTPASK
PPTSGADSPEACAQACYTAYNVCRGKPDANRSTCASEYAGCLGYNPFGSDGSLVTPTACSTAGGSPTAGSSPSGG
SSPGASGVPGEYPSGDAHPSGNGASGAGYLEACAEACKNAHNACRTRANANLSTCGSEYASCLGYGNSGSSGSLL
GLTACSQSLTPTTTPDTSGGSPNPSSAGNKVPIQGSSEATGGGDASATGGAGPSGGAAPVVTAGGHGVRPTAMAM
MVAVGLACL*
Coding >Ophcf2|02656
ATGAAGTACGCATATACCATCGTCGGCTTCGCTCTCGCCTCGTCGAGCTTCGCAGACGAATGCGTTCGAAAGTGC
AACGAAGCTCACAACGCCTGCCTCGGCAAGCCCAACGCCCATCGCCCAACGTGCGCCTCCGACTACGCGGCTTGT
CTAGGCTACAACCCATATACCCAGGGAGATTACTCAACACCGACAGCATGCTCCAAGGCGGCTCAGCCAACGGAT
TCACCCTCGCCCGAGGCATGTGACTGCGCCAAGAATTGCAACTACGAATACAACGCTTGCAGAGGAAAGCCTGAT
GCCAATCGGTCAACGTGCGCCGCCAGCTACAGCACGTGTCTGGGTTACAGTCCCTTTGGCCCGGACGGCTCTCTC
ATTCCGCCCACTGCCTGCGCCCCAGGCGCCGCGCGGGCTGGTGCTCCGGGCGGTGGTGCTCCGAGCGGTGTTGCC
CCTGGCATTGGTGCCCCTGCCACTGACAGCCCGACCATCGAGACCCCGCCGGGCGAGGACACGGGGAGCTCCGTC
GTCCCTGGTCAAGGCGATTATCCCGGCACTTTCCCCGGCGGCGTTCCGTCTGGCGTCGGCCCTGTTACCGGCTAT
CCTCCAAGCGAAAGTACACCCAGCGCGGCCGTCCCGGTAGGCAACGGCCCGAGCGGGAGTACCCCGGCCAGCAAA
CCCCCAACAAGCGGCGCAGACAGTCCCGAAGCTTGCGCCCAGGCTTGCTACACTGCGTACAACGTCTGCCGAGGC
AAGCCCGACGCCAACCGGTCAACGTGTGCCTCTGAGTACGCCGGCTGTCTCGGTTACAACCCCTTTGGTTCTGAC
GGATCGCTGGTGACGCCGACTGCGTGTTCTACGGCCGGCGGTTCGCCGACTGCCGGTTCGTCTCCCAGCGGCGGC
AGCAGTCCCGGCGCAAGCGGTGTTCCTGGCGAATATCCAAGCGGAGATGCTCATCCCAGCGGAAACGGTGCCTCC
GGCGCGGGCTATCTCGAGGCCTGTGCCGAGGCGTGCAAGAATGCACACAACGCCTGCCGCACAAGGGCAAACGCC
AACCTGTCGACCTGTGGCTCCGAATACGCCAGCTGTCTAGGCTACGGCAACTCAGGCTCAAGCGGCTCGCTCCTC
GGGCTAACAGCCTGTTCTCAGTCCCTGACCCCAACAACTACCCCGGATACCAGCGGCGGAAGCCCCAACCCTTCA
TCAGCGGGGAACAAGGTCCCCATCCAAGGCTCTTCCGAGGCCACCGGCGGCGGCGATGCCTCCGCGACGGGCGGC
GCTGGGCCCTCGGGCGGCGCGGCCCCTGTTGTCACGGCGGGTGGACATGGTGTTAGACCTACGGCTATGGCCATG
ATGGTGGCTGTTGGGCTAGCGTGTCTGTGA
Transcript >Ophcf2|02656
ATGAAGTACGCATATACCATCGTCGGCTTCGCTCTCGCCTCGTCGAGCTTCGCAGACGAATGCGTTCGAAAGTGC
AACGAAGCTCACAACGCCTGCCTCGGCAAGCCCAACGCCCATCGCCCAACGTGCGCCTCCGACTACGCGGCTTGT
CTAGGCTACAACCCATATACCCAGGGAGATTACTCAACACCGACAGCATGCTCCAAGGCGGCTCAGCCAACGGAT
TCACCCTCGCCCGAGGCATGTGACTGCGCCAAGAATTGCAACTACGAATACAACGCTTGCAGAGGAAAGCCTGAT
GCCAATCGGTCAACGTGCGCCGCCAGCTACAGCACGTGTCTGGGTTACAGTCCCTTTGGCCCGGACGGCTCTCTC
ATTCCGCCCACTGCCTGCGCCCCAGGCGCCGCGCGGGCTGGTGCTCCGGGCGGTGGTGCTCCGAGCGGTGTTGCC
CCTGGCATTGGTGCCCCTGCCACTGACAGCCCGACCATCGAGACCCCGCCGGGCGAGGACACGGGGAGCTCCGTC
GTCCCTGGTCAAGGCGATTATCCCGGCACTTTCCCCGGCGGCGTTCCGTCTGGCGTCGGCCCTGTTACCGGCTAT
CCTCCAAGCGAAAGTACACCCAGCGCGGCCGTCCCGGTAGGCAACGGCCCGAGCGGGAGTACCCCGGCCAGCAAA
CCCCCAACAAGCGGCGCAGACAGTCCCGAAGCTTGCGCCCAGGCTTGCTACACTGCGTACAACGTCTGCCGAGGC
AAGCCCGACGCCAACCGGTCAACGTGTGCCTCTGAGTACGCCGGCTGTCTCGGTTACAACCCCTTTGGTTCTGAC
GGATCGCTGGTGACGCCGACTGCGTGTTCTACGGCCGGCGGTTCGCCGACTGCCGGTTCGTCTCCCAGCGGCGGC
AGCAGTCCCGGCGCAAGCGGTGTTCCTGGCGAATATCCAAGCGGAGATGCTCATCCCAGCGGAAACGGTGCCTCC
GGCGCGGGCTATCTCGAGGCCTGTGCCGAGGCGTGCAAGAATGCACACAACGCCTGCCGCACAAGGGCAAACGCC
AACCTGTCGACCTGTGGCTCCGAATACGCCAGCTGTCTAGGCTACGGCAACTCAGGCTCAAGCGGCTCGCTCCTC
GGGCTAACAGCCTGTTCTCAGTCCCTGACCCCAACAACTACCCCGGATACCAGCGGCGGAAGCCCCAACCCTTCA
TCAGCGGGGAACAAGGTCCCCATCCAAGGCTCTTCCGAGGCCACCGGCGGCGGCGATGCCTCCGCGACGGGCGGC
GCTGGGCCCTCGGGCGGCGCGGCCCCTGTTGTCACGGCGGGTGGACATGGTGTTAGACCTACGGCTATGGCCATG
ATGGTGGCTGTTGGGCTAGCGTGTCTGTGA
Gene >Ophcf2|02656
ATGAAGTACGCATATACCATCGTCGGCTTCGCTCTCGCCTCGTCGAGCTTCGCAGACGAATGCGTTCGAAAGTGC
AACGAAGCTCACAACGCCTGCCTCGGCAAGCCCAACGCCCATCGCCCAACGTGCGCCTCCGACTACGCGGCTTGT
CTAGGCTACAACCCATATACCCAGGGAGATTACTCAACACCGACAGCATGCTCCAAGGCGGCTCAGCCAACGGAT
TCACCCTCGCCCGAGGCATGTGACTGCGCCAAGAATTGCAACTACGAATACAACGCTTGCAGAGGAAAGCCTGAT
GCCAATCGGTCAACGTGCGCCGCCAGCTACAGCACGTGTCTGGGTTACAGTCCCTTTGGCCCGGACGGCTCTCTC
ATTCCGCCCACTGCCTGCGCCCCAGGCGCCGCGCGGGCTGGTGCTCCGGGCGGTGGTGCTCCGAGCGGTGTTGCC
CCTGGCATTGGTGCCCCTGCCACTGACAGCCCGACCATCGAGACCCCGCCGGGCGAGGACACGGGGAGCTCCGTC
GTCCCTGGTCAAGGCGATTATCCCGGCACTTTCCCCGGCGGCGTTCCGTCTGGCGTCGGCCCTGTTACCGGCTAT
CCTCCAAGCGAAAGTACACCCAGCGCGGCCGTCCCGGTAGGCAACGGCCCGAGCGGGAGTACCCCGGCCAGCAAA
CCCCCAACAAGCGGCGCAGACAGTCCCGAAGCTTGCGCCCAGGCTTGCTACACTGCGTACAACGTCTGCCGAGGC
AAGCCCGACGCCAACCGGTCAACGTGTGCCTCTGAGTACGCCGGCTGTCTCGGTTACAACCCCTTTGGTTCTGAC
GGATCGCTGGTGACGCCGACTGCGTGTTCTACGGCCGGCGGTTCGCCGACTGCCGGTTCGTCTCCCAGCGGCGGC
AGCAGTCCCGGCGCAAGCGGTGTTCCTGGCGAATATCCAAGCGGAGATGCTCATCCCAGCGGAAACGGTGCCTCC
GGCGCGGGCTATCTCGAGGCCTGTGCCGAGGCGTGCAAGAATGCACACAACGCCTGCCGCACAAGGGCAAACGCC
AACCTGTCGACCTGTGGCTCCGAATACGCCAGCTGTCTAGGCTACGGCAACTCAGGCTCAAGCGGCTCGCTCCTC
GGGCTAACAGCCTGTTCTCAGTCCCTGACCCCAACAACTACCCCGGATACCAGCGGCGGAAGCCCCAACCCTTCA
TCAGCGGGGAACAAGGTCCCCATCCAAGGCTCTTCCGAGGCCACCGGCGGCGGCGATGCCTCCGCGACGGGCGGC
GCTGGGCCCTCGGGCGGCGCGGCCCCTGTTGTCACGGCGGGTGGACATGGTGTTAGACCTACGGCTATGGCCATG
ATGGTGGCTGTTGGGCTAGCGTGTCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail