Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|02649
Gene name
Locationscaffold_02:4338190..4339084
Strand+
Gene length (bp)894
Transcript length (bp)843
Coding sequence length (bp)843
Protein length (aa) 281

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 3.0E-14 51 110
PF04193 PQ-loop PQ loop repeat 2.5E-07 166 220

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 82 101 19
2 111 133 22
3 138 155 17
4 165 187 22
5 194 213 19
6 223 245 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|02649
MDALRAGLQPLTHNLPVPLRDLGVSLLGPECYRSLVLDIDLSASECLKLAVSKGLGVAIVCAASIVKLPQIIKLV
RARSADGVSFLSYLLETSALLITLAYNVRNGFPFSTYGESALILVQDVVISVLVLNYGGKAPAAAVMIAALAAVA
TVLFSDSPLGPDKLAYLQAAAGLLGVASKLPQIAAIWQQGGTGQLSAFAVFNYLLGSLSRIFTTLQEVDDKLILY
GFVSGFVLNAILALQMLYYWNAPSEKLRGKRRETPMAMTTSTSTSGKSPTTRRRG*
Coding >Ophcf2|02649
ATGGACGCTCTCCGCGCCGGCCTCCAGCCGCTGACGCACAATCTCCCCGTCCCACTGCGCGACCTAGGCGTCTCT
CTTCTCGGCCCCGAGTGCTATCGCTCCCTCGTCCTCGACATCGACCTCTCGGCCTCGGAATGCCTCAAGCTGGCC
GTCAGCAAGGGCCTCGGCGTGGCCATCGTCTGCGCCGCCTCCATCGTCAAGCTGCCTCAGATTATCAAGCTCGTC
CGCGCTCGCTCTGCCGATGGCGTCTCTTTCCTGTCGTATCTCCTCGAGACGAGCGCGTTGCTCATCACGCTCGCG
TACAACGTCCGCAATGGCTTCCCCTTTAGCACCTACGGCGAGTCGGCCTTGATCCTCGTCCAGGACGTCGTCATC
TCCGTCCTCGTTCTCAACTACGGCGGAAAGGCGCCCGCCGCCGCCGTCATGATCGCTGCTCTTGCAGCCGTCGCT
ACGGTGCTCTTCTCCGATAGCCCCCTGGGTCCCGACAAGTTGGCCTACTTGCAGGCTGCCGCCGGCCTCCTGGGC
GTCGCCAGCAAGCTTCCGCAGATTGCGGCAATCTGGCAGCAGGGAGGCACCGGCCAGCTGAGCGCCTTTGCTGTC
TTCAATTACCTCCTCGGCTCGCTGTCGCGCATCTTCACGACACTTCAAGAGGTCGATGACAAGCTGATTCTCTAC
GGCTTCGTGTCCGGCTTCGTCCTCAACGCCATCCTCGCCCTGCAGATGTTATACTACTGGAACGCGCCGTCGGAA
AAGCTCAGGGGCAAGCGCAGGGAGACGCCCATGGCCATGACTACGTCCACGTCGACGTCCGGCAAGAGTCCGACG
ACTCGGCGTCGAGGATAG
Transcript >Ophcf2|02649
ATGGACGCTCTCCGCGCCGGCCTCCAGCCGCTGACGCACAATCTCCCCGTCCCACTGCGCGACCTAGGCGTCTCT
CTTCTCGGCCCCGAGTGCTATCGCTCCCTCGTCCTCGACATCGACCTCTCGGCCTCGGAATGCCTCAAGCTGGCC
GTCAGCAAGGGCCTCGGCGTGGCCATCGTCTGCGCCGCCTCCATCGTCAAGCTGCCTCAGATTATCAAGCTCGTC
CGCGCTCGCTCTGCCGATGGCGTCTCTTTCCTGTCGTATCTCCTCGAGACGAGCGCGTTGCTCATCACGCTCGCG
TACAACGTCCGCAATGGCTTCCCCTTTAGCACCTACGGCGAGTCGGCCTTGATCCTCGTCCAGGACGTCGTCATC
TCCGTCCTCGTTCTCAACTACGGCGGAAAGGCGCCCGCCGCCGCCGTCATGATCGCTGCTCTTGCAGCCGTCGCT
ACGGTGCTCTTCTCCGATAGCCCCCTGGGTCCCGACAAGTTGGCCTACTTGCAGGCTGCCGCCGGCCTCCTGGGC
GTCGCCAGCAAGCTTCCGCAGATTGCGGCAATCTGGCAGCAGGGAGGCACCGGCCAGCTGAGCGCCTTTGCTGTC
TTCAATTACCTCCTCGGCTCGCTGTCGCGCATCTTCACGACACTTCAAGAGGTCGATGACAAGCTGATTCTCTAC
GGCTTCGTGTCCGGCTTCGTCCTCAACGCCATCCTCGCCCTGCAGATGTTATACTACTGGAACGCGCCGTCGGAA
AAGCTCAGGGGCAAGCGCAGGGAGACGCCCATGGCCATGACTACGTCCACGTCGACGTCCGGCAAGAGTCCGACG
ACTCGGCGTCGAGGATAG
Gene >Ophcf2|02649
ATGGACGCTCTCCGCGCCGGCCTCCAGCCGCTGACGCACAATCTCCCCGTCCCACTGCGCGACCTAGGCGTCTCT
CTTCTCGGCCCCGAGTGCTATCGCTCCCTCGTCCTCGACATCGACCTCTCGGCCTCGGAATGCCTCAAGCTGGCC
GTCAGCAAGGGCCTCGGCGTGGCCATCGTCTGCGCCGCCTCCATCGTCAAGCTGCCTCAGATTATCAAGCTCGTC
CGCGCTCGCTCTGCCGATGGCGTCTCTTTCCTGTCGTATCTCCTCGAGACGAGCGCGTTGCTCATCACGCTCGCG
TACAACGTCCGCAATGGCTTCCCCTTTAGCACCTACGGCGAGTCGGCCTTGATCCTCGTCCAGGACGTCGTCATC
TCCGTCCTCGTTCTCAACTACGGCGGAAAGGCGCCCGCCGCCGCCGTCATGATCGCTGCTCTTGCAGCCGTCGCT
ACGGTGCTCTTCTCCGATAGCCCCCTGGGTCCCGACAAGTTGGCCTACTTGCAGGCTGCCGCCGGCCTCCTGGGC
GTCGCCAGCAAGCTTCCGCAGATTGCGGCAATCTGGCAGCAGGGAGGCACCGGCCAGCTGAGCGCCTTTGCTGTA
ATCGAAGCCAATCGTACCCTCCCTCGTCGTCATTGACTGACTTTACAGGTCTTCAATTACCTCCTCGGCTCGCTG
TCGCGCATCTTCACGACACTTCAAGAGGTCGATGACAAGCTGATTCTCTACGGCTTCGTGTCCGGCTTCGTCCTC
AACGCCATCCTCGCCCTGCAGATGTTATACTACTGGAACGCGCCGTCGGAAAAGCTCAGGGGCAAGCGCAGGGAG
ACGCCCATGGCCATGACTACGTCCACGTCGACGTCCGGCAAGAGTCCGACGACTCGGCGTCGAGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail